CAZyme Information: CAP80966:RNA-p1

Basic Information

• Species: Penicillium rubens
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Penicillium; Penicillium rubens
• CAZyme ID: CAP80966:RNA-p1
• CAZy Family: AA7
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
457	Pc00c12|CGC10	49897.64	4.3055

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PrubensWisconsin54-1255	14021	500485	1464	12557

• Gene Location: location=Pc00c12:3215017-3216602(-)

Full Sequence      

MHLLGHCSSSRAAIFALLLSSIARAIDLDISDEQSIKDAASTSTYAMMKYYYGNETGQIP
GAFPDKWWEGAPLFMALLEYWHFTGDTTYNEELSVGLQWQGGTDGDYMPGNYSSYLGNDD
QMFWGLAAMTAAEFGFPDRSTGFSWLSLAQGVFNTQIKRWDTSSCGGGLRWQIWPYQSGY
TMKNSISNGGLFQLSARLARYTGDAIYLQWANKIWDWSVSSPLLSNTTWNVADSAVVGDN
CATQGNAQWTYNYGTYLMGAAYMYNYTNGTIQAQWLTAVNGLLNATFNNFFLTGGIIEDY
YCEPTETCNNNEILFKGLTSSWLALTALLVPSTFDSILAKLQKSGQAAAASCTGHNNGTC
GVQWYRSTWDGWMGMEEQISATKVFIANLINFNKTAPVTSTTGGNSTSNPTAGEDDTDGS
NQMRTTTTTADKAGAGIVTAVFVAGWIGLMSFMMLGG

Enzyme Prediction     

No EC number prediction in CAP80966:RNA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	32	398	1.4e-101	0.9608938547486033

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397638	Glyco_hydro_76	3.84e-171	35	381	1	347	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.
227170	COG4833	1.03e-07	111	331	82	282	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAP80966.1|GH76	0.0	1	457	1	457
QQK40798.1|GH76	4.17e-298	1	457	1	457
CAP92936.1|GH76	8.65e-223	1	457	1	455
BAE55608.1|GH76	7.47e-220	24	444	25	446
QMW26300.1|GH76	7.47e-220	24	444	25	446

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6RY0_A	1.02e-79	30	364	30	373	Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY1_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY2_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY5_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY6_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY7_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P36091|DCW1_YEAST	2.16e-111	17	441	13	435	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DCW1 PE=1 SV=1
sp|Q75DG6|DCW1_ASHGO	1.18e-102	12	441	9	437	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=DCW1 PE=3 SV=2
sp|Q6FLP9|DCW1_CANGA	4.04e-102	26	441	19	432	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) OX=284593 GN=DCW1 PE=3 SV=1
sp|Q9P6I3|YHG7_SCHPO	4.01e-101	30	442	24	429	Putative mannan endo-1,6-alpha-mannosidase C1198.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1198.07c PE=3 SV=2
sp|O74556|YCZ2_SCHPO	1.42e-98	16	413	10	407	Putative mannan endo-1,6-alpha-mannosidase C970.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC970.02 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000284	0.999657	CS pos: 25-26. Pr: 0.9702

TMHMM  Annotations     

Start	End
433	455