CAZyme Information: CAP80802:RNA-p1

Basic Information

• Species: Penicillium rubens
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Penicillium; Penicillium rubens
• CAZyme ID: CAP80802:RNA-p1
• CAZy Family: AA7
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
667	Pc00c12|CGC11	74466.86	6.4003

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PrubensWisconsin54-1255	14021	500485	1464	12557

• Gene Location: location=Pc00c12:2807890-2810058(-)

Full Sequence      

MTASYPRPDFQRTSLNWNTLDGPWSFTFDDKDEGLSSQWHKNSLEGKPSHQIIVPYAFQT
PASGVNLIEAHEVMWYERRITDIRTADEKQKGNRLLLRFGAVDYECSVWVNGVLVGGHRG
GHVPFDIDISDALADGVTEARLTLRVRDSPYDMTQPRGKQFWGPVPESIFYTPSGGIWLS
VWLESVPGMRLLCGSGGTVLRSDDIEGGQLHAKVHVAGRRAGSRAKAEVEVSLGGTSVAK
VDGELPRDKTFIALDLGMKVTDAAVADLKAKNQGLFGVDGVWSRGVALWAPEHPVLYDIT
LRLFGGDGSLVDEVQTTTGMRSLSWQNGDGTFRLNGKPYFQMLFLDQGYWPQTGMTPPSS
EALKTDIQLAQKLGFNGCRKHQKVEDPRFYYWADRMGFLVWGEMANAYEFGTEYIDRFTS
EWTEAVKRDINHPSIVTWTPLNESWGVSALKDNIEQRNHVRALYYLTKTLDPSRPINDNC
GWEHVKTDLTTFHDYSDSAELGAACTNMPAILEPKGGHEIFTKPIYSGYSGSSIVDKGAQ
HTPGAPVICSEFGGVNIAPPKNSAAAGERDWGYTTASDPADFLVRFEKLVMAVVKPGHIC
GLVWTQLCDIEQEVNGLYTYDRQEKVPTEKVKAIMDAARDHYYHHVTSHHSKGFRKLLDQ
YKHVVHR

Enzyme Prediction     

No EC number prediction in CAP80802:RNA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	12	500	8.9e-100	0.5132978723404256

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225789	LacZ	2.48e-36	6	477	6	430	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
236657	PRK10150	5.28e-28	20	525	15	504	beta-D-glucuronidase; Provisional
236673	ebgA	8.87e-21	4	474	23	470	cryptic beta-D-galactosidase subunit alpha; Reviewed
236548	lacZ	3.52e-16	108	476	153	485	beta-galactosidase.
397120	Glyco_hydro_2_N	2.21e-14	19	187	3	169	Glycosyl hydrolases family 2, sugar binding domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities and has a jelly-roll fold. The domain binds the sugar moiety during the sugar-hydrolysis reaction.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAP80802.1|GH2	0.0	1	667	1	667
QQK40685.1|GH2	0.0	1	667	28	670
QRD91609.1|GH2	0.0	3	646	2	646
QMW47280.1|GH2	0.0	3	646	2	646
QMW35218.1|GH2	0.0	3	646	2	646

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7SF2_A	4.61e-62	5	623	29	566	Chain A, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_C Chain C, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_D Chain D, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_E Chain E, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_F Chain F, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838]
5C70_A	6.45e-20	11	535	14	519	The structure of Aspergillus oryzae beta-glucuronidase [Aspergillus oryzae],5C70_B The structure of Aspergillus oryzae beta-glucuronidase [Aspergillus oryzae]
1BHG_A	1.50e-19	5	476	9	459	Human Beta-Glucuronidase At 2.6 A Resolution [Homo sapiens],1BHG_B Human Beta-Glucuronidase At 2.6 A Resolution [Homo sapiens],3HN3_A Human beta-glucuronidase at 1.7 A resolution [Homo sapiens],3HN3_B Human beta-glucuronidase at 1.7 A resolution [Homo sapiens],3HN3_D Human beta-glucuronidase at 1.7 A resolution [Homo sapiens],3HN3_E Human beta-glucuronidase at 1.7 A resolution [Homo sapiens]
6ECA_A	2.06e-19	5	472	31	463	Lactobacillus rhamnosus Beta-glucuronidase [Lacticaseibacillus rhamnosus],6ECA_B Lactobacillus rhamnosus Beta-glucuronidase [Lacticaseibacillus rhamnosus]
5C71_A	2.11e-19	11	535	39	544	The structure of Aspergillus oryzae a-glucuronidase complexed with glycyrrhetinic acid monoglucuronide [Aspergillus oryzae],5C71_B The structure of Aspergillus oryzae a-glucuronidase complexed with glycyrrhetinic acid monoglucuronide [Aspergillus oryzae],5C71_C The structure of Aspergillus oryzae a-glucuronidase complexed with glycyrrhetinic acid monoglucuronide [Aspergillus oryzae],5C71_D The structure of Aspergillus oryzae a-glucuronidase complexed with glycyrrhetinic acid monoglucuronide [Aspergillus oryzae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O18835|BGLR_CANLF	3.54e-24	5	543	29	553	Beta-glucuronidase OS=Canis lupus familiaris OX=9615 GN=GUSB PE=1 SV=1
sp|P77989|BGAL_THEP3	2.41e-23	12	495	3	433	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2
sp|O97524|BGLR_FELCA	1.85e-22	5	543	29	553	Beta-glucuronidase OS=Felis catus OX=9685 GN=GUSB PE=1 SV=1
sp|P06760|BGLR_RAT	3.07e-21	14	543	35	549	Beta-glucuronidase OS=Rattus norvegicus OX=10116 GN=Gusb PE=1 SV=1
sp|P12265|BGLR_MOUSE	6.75e-20	14	476	35	475	Beta-glucuronidase OS=Mus musculus OX=10090 GN=Gusb PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000073	0.000000

TMHMM  Annotations     

There is no transmembrane helices in CAP80802:RNA-p1.