CAZyme Information: CAP80738:RNA-p1

Basic Information

• Species: Penicillium rubens
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Penicillium; Penicillium rubens
• CAZyme ID: CAP80738:RNA-p1
• CAZy Family: AA7
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
869	Pc00c12|CGC4	93721.37	5.1746

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PrubensWisconsin54-1255	14021	500485	1464	12557

• Gene Location: location=Pc00c12:2636817-2639528(+)

Full Sequence      

MAPWAHLALASVFTPLLLASPVPDESESTHSHKRAAEGYDSPPYYPTPPGGWVPDWSEAY
SKAHDLVSNMTLAEKVNLTTGTGFFMGPCVGQTGSVPRLGIPNLCLQDSPLGIRNSDHNT
AFPPGITVGATFNKDLMYERGVALGEEARGKGVNVLLGPSVGALGRKPRGGRNWEGFGAD
PTLQALGGAQTVKGMQSTGAIAAIKHYIGNEQEMHRMSSIVTKGYSSNIDDRTLHELYLW
PFAEGVRAGVGSLMTAYSDVNSSSCSQSSKLLNGILKDELGFQGFVMTDWLGHYSGVASA
IAGLDMSMPGDGAVPLFGDSYWGSELSRSVLNGSVPVDRLNDMVQRIVATWYKYGQDKDY
PLPNFSTNTQDKEGPLYPGALFSPSGVVNQFVDVTSNHNITARAVAREAITLLKNDMDIL
PLHSDDSLKVFGTDAGRNPDGLNSCADQGCNKGVLTMGWGSGTARLPYLITPQEAISSIA
KNAEFHITDKFPSGVTVSPDDIALVFISADSGENFITVEGNPGDRTKAGLNAWHDGDELV
KAAAEKFSNVVVIVHTVGPILMEEWIELKSVKAVVVAHLPGQEAGNSLTDVIFGDYSPSG
HMPYTIPRSEDDYPDSVDLISQPFGQIQDTYTEGLYIDYRHFIKANLTPRYAFGHGLSYT
TFNFSQPSLSTKTPLDSAYPAARPTKLPTPSYNTSIPDASEVAWSSAKFTRIWRYLYPYL
DKPESITATKKYAYPEGYSTEPHEVPRAGGGEGGNPALFETVFSVQLEVRNTGKRTGKAV
AQLYVELPSSLGLDTPALQLRQFEKTKELAPGQSETVTLHLTRKDVSVWDVVVQDWKAPV
NGEGIKIWVGNSVADLPVLCVVGGKCSVQ

Enzyme Prediction     

EC	3.2.1.21:13

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	95	309	8.1e-62	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396478	Glyco_hydro_3_C	1.07e-52	410	639	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
224389	BglX	4.59e-50	97	441	56	370	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
185053	PRK15098	2.19e-46	98	830	101	734	beta-glucosidase BglX.
395747	Glyco_hydro_3	8.05e-37	98	347	63	313	Glycosyl hydrolase family 3 N terminal domain.
178629	PLN03080	2.04e-24	61	677	51	657	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAP80738.1|GH3	0.0	1	869	1	869
UDD55180.1|GH3	0.0	5	867	6	864
BAE57053.1|GH3|3.2.1.21	0.0	5	867	6	864
QMW39401.1|GH3	0.0	5	867	6	864
QMW27330.1|GH3	0.0	5	867	6	864

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4IIB_A	8.26e-236	41	858	6	833	Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus [Aspergillus aculeatus],4IIB_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus [Aspergillus aculeatus],4IIC_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with isofagomine [Aspergillus aculeatus],4IIC_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with isofagomine [Aspergillus aculeatus],4IID_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with 1-deoxynojirimycin [Aspergillus aculeatus],4IID_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with 1-deoxynojirimycin [Aspergillus aculeatus],4IIE_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with calystegine B(2) [Aspergillus aculeatus],4IIE_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with calystegine B(2) [Aspergillus aculeatus],4IIF_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with castanospermine [Aspergillus aculeatus],4IIF_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with castanospermine [Aspergillus aculeatus],4IIG_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with D-glucose [Aspergillus aculeatus],4IIG_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with D-glucose [Aspergillus aculeatus],4IIH_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with thiocellobiose [Aspergillus aculeatus],4IIH_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with thiocellobiose [Aspergillus aculeatus]
5JU6_A	2.78e-235	41	858	25	847	Chain A, Beta-glucosidase [Rasamsonia emersonii],5JU6_B Chain B, Beta-glucosidase [Rasamsonia emersonii],5JU6_C Chain C, Beta-glucosidase [Rasamsonia emersonii],5JU6_D Chain D, Beta-glucosidase [Rasamsonia emersonii]
5FJJ_A	2.47e-232	41	858	7	834	Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae],5FJJ_B Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae],5FJJ_C Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae],5FJJ_D Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae]
5FJI_A	2.75e-226	41	858	6	836	Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus fumigatus],5FJI_B Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus fumigatus]
5NBS_A	2.95e-226	41	852	20	846	Structural studies of a Glycoside Hydrolase Family 3 beta-glucosidase from the Model Fungus Neurospora crassa [Neurospora crassa OR74A],5NBS_B Structural studies of a Glycoside Hydrolase Family 3 beta-glucosidase from the Model Fungus Neurospora crassa [Neurospora crassa OR74A]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0CI67|BGLF_ASPTN	0.0	15	867	15	865	Probable beta-glucosidase F OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=bglF PE=3 SV=1
sp|B0Y7Q8|BGLF_ASPFC	0.0	7	868	7	868	Probable beta-glucosidase F OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglF PE=3 SV=2
sp|B8NP65|BGLF_ASPFN	0.0	5	867	6	864	Probable beta-glucosidase F OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglF PE=3 SV=1
sp|Q5B6C6|BGLF_EMENI	0.0	4	866	5	865	Probable beta-glucosidase F OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglF PE=3 SV=2
sp|Q2UN12|BGLF_ASPOR	0.0	5	867	6	864	Probable beta-glucosidase F OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000580	0.999385	CS pos: 19-20. Pr: 0.9742

TMHMM  Annotations     

There is no transmembrane helices in CAP80738:RNA-p1.