CAZyme Information: CAP80736:RNA-p1

Basic Information

• Species: Penicillium rubens
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Penicillium; Penicillium rubens
• CAZyme ID: CAP80736:RNA-p1
• CAZy Family: AA7
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
344	Pc00c12|CGC25	38303.60	5.5162

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PrubensWisconsin54-1255	14021	500485	1464	12557

• Gene Location: location=Pc00c12:2633335-2634369(-)

Full Sequence      

MGRFHYLLGLLLLFICSFLWIASSLGKQPSNIFITHGSCVCSEDNVTVASDGGDIPSNQP
KAPIKDMNPISEPNIPSYLPIANSHDDHAQPSIPLKLWQKAGSMKINDARQKDIHSWLDA
NPRLRHEILTDESADEYVREHFADYPDVLDLYLSLPVPILKADLLRQLILYADGGIWSDL
DVTCRRPIHTWIPDQYRNRANVVVGLEFDGFQFSSWTIMTKPKTSHVVAIIEYVIDKLKA
SAAQHSVTTAELNMTMISDVVDVTGPQAMTVALLQNLQKEMGVPFGRANITDIKEPTLFQ
DVLVLPNAAFASRQAGFPEDRGPYLVEHHYAGSWKNANGGETQS

Enzyme Prediction     

No EC number prediction in CAP80736:RNA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	111	194	2.8e-21	0.9444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	2.59e-20	63	247	55	252	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	6.32e-17	111	197	5	92	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAP80736.1|GT32	6.63e-256	1	344	1	344
QQK40626.1|GT32	5.24e-205	1	344	2	344
BCS30122.1|GT32	9.15e-99	89	341	107	363
EAA62114.1|GT32	1.53e-96	89	341	108	364
CAK40793.1|GT32	7.07e-82	88	341	95	350

PDB Hits     

CAP80736:RNA-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UTR6|OCH1_SCHPO	4.86e-27	93	336	142	395	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|Q5A4E3|OCH1_CANAL	3.13e-23	87	336	94	377	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P47124|HOC1_YEAST	6.24e-18	85	336	124	389	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|P31755|OCH1_YEAST	1.31e-10	74	252	79	300	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|Q10323|IMT3_SCHPO	1.01e-07	84	188	51	149	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000277	0.999703	CS pos: 26-27. Pr: 0.8874

TMHMM  Annotations     

Start	End
7	26