CAZyme Information: CAP80622:RNA-p1

Basic Information

• Species: Penicillium rubens
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Penicillium; Penicillium rubens
• CAZyme ID: CAP80622:RNA-p1
• CAZy Family: AA7
• CAZyme Description: alcohol oxidase aox-Penicillium chrysogenum

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
666	Pc00c12|CGC14	73907.40	7.2690

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PrubensWisconsin54-1255	14021	500485	1464	12557

• Gene Location: location=Pc00c12:2331513-2334015(-)

Full Sequence      

MTIPEEVDIIICGGGSSGCVPAGRLANLDHNLSVLLIEAGEDNLNNQWVYRPGIYPNNMK
LDSKTASFYSSRPSEHLDGRQAIVPCANILGGGSSINFMMYTRASASDYDDFQAKGWTTK
ELLPLMRKHETYQRASNNPELHGSDGPIKVSFGNYTYPIKNDFLRAVETQGIPFTDDLQD
LKTAHGAEHWLKWINRDTGRRSDAAHAYVHSTRAKHSNLHLQCNTKVEKVIVENGRAVGV
VTVPTKPLGGGEPVRRIFKARKQIIISSGTMSSPLILQRSGFGDPEKLRRAGVKPLVNLP
GVGRNFQDHYLTFSVYRAKPDVESFDDFIRGDPKVQKKVFDEWDKKGTGPLATNGIDAGV
KIRPTEQELGDMKKWPTPDFTEGYESYFRNKPDKPVMHYSIISGWFGDHMHMPPGKFFTM
FHFLEYPFSRGHTHIQSADPYEVPDFDAGFMNDKRDMAPLVWGYIKSRETARRMGSYAGE
VTGMHPQFASNSSARAQDMDLATTKAYAGPNHISAGIQHGSWTTPLEPGKQPSASILNSN
RHEARAPLEYSDEDIKHIEKWVSRHVETTWHCLGTCSMAPREGNSIAPHGGVVDERLNVH
GVKGLKVCDLSICPDNVGCNTFSTALLIGEKCAVLVAEDLGYSGADLDMKVPTYHAPAEF
SNLSRL

Enzyme Prediction     

EC	1.1.3.13:12

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	5	641	2.2e-254	0.9983050847457627

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	1.80e-74	1	639	2	536	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	2.32e-73	5	633	4	528	choline dehydrogenase; Validated
366272	GMC_oxred_N	3.17e-43	78	310	15	217	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
274888	Rv0697	6.80e-43	8	637	2	487	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.
398739	GMC_oxred_C	1.94e-26	427	632	1	143	GMC oxidoreductase. This domain found associated with pfam00732.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAL56054.1|AA3_3	0.0	1	666	1	666
BCS18686.1|AA3_3	0.0	1	666	1	666
QMW39314.1|AA3_3	0.0	1	666	1	666
QMW27243.1|AA3_3	0.0	1	666	1	666
QRD81611.1|AA3_3	0.0	1	666	1	666

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HSA_A	0.0	1	654	1	650	Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_B Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_C Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_D Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_E Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_F Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_G Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_H Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5I68_A Chain A, Alcohol oxidase 1 [Komagataella pastoris]
6H3G_A	8.62e-239	4	657	4	634	Chain A, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_B Chain B, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_C Chain C, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_D Chain D, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_E Chain E, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_F Chain F, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_G Chain G, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_H Chain H, Alcohol oxidase [Phanerodontia chrysosporium]
6H3O_A	1.40e-237	4	657	4	634	Chain A, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_B Chain B, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_C Chain C, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_D Chain D, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_E Chain E, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_F Chain F, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_G Chain G, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_H Chain H, Alcohol oxidase [Phanerodontia chrysosporium]
6ZH7_A	2.56e-46	3	636	4	560	Chain A, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis],6ZH7_B Chain B, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
6YRU_AAA	4.78e-46	5	636	6	560	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRV_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRX_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRZ_AAA Chain AAA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|F2QY27|ALOX1_KOMPC	0.0	1	654	1	650	Alcohol oxidase 1 OS=Komagataella phaffii (strain ATCC 76273 / CBS 7435 / CECT 11047 / NRRL Y-11430 / Wegner 21-1) OX=981350 GN=AOX1 PE=1 SV=1
sp|P04841|ALOX_PICAN	0.0	1	654	1	651	Alcohol oxidase OS=Pichia angusta OX=870730 GN=MOX PE=1 SV=1
sp|F2R038|ALOX2_KOMPC	0.0	1	654	1	650	Alcohol oxidase 2 OS=Komagataella phaffii (strain ATCC 76273 / CBS 7435 / CECT 11047 / NRRL Y-11430 / Wegner 21-1) OX=981350 GN=AOX2 PE=2 SV=1
sp|P04842|ALOX1_KOMPG	0.0	1	654	1	650	Alcohol oxidase 1 OS=Komagataella phaffii (strain GS115 / ATCC 20864) OX=644223 GN=AOX1 PE=1 SV=2
sp|C4R702|ALOX2_KOMPG	0.0	1	654	1	650	Alcohol oxidase 2 OS=Komagataella phaffii (strain GS115 / ATCC 20864) OX=644223 GN=AOX2 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000056	0.000007

TMHMM  Annotations     

There is no transmembrane helices in CAP80622:RNA-p1.