CAZyme Information: CAP79838:RNA-p1

Basic Information

• Species: Penicillium rubens
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Penicillium; Penicillium rubens
• CAZyme ID: CAP79838:RNA-p1
• CAZy Family: AA3
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
306		34120.88	9.4565

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PrubensWisconsin54-1255	14021	500485	1464	12557

• Gene Location: location=Pc00c12:476785-477934(+)

Full Sequence      

MYVLDAATYYTNYGMNTVSLATTPVLPLYDQIRLSSKLNSHCLTHGTNGIPPNIARQIKH
LQQTGQNKTKLAAYHGIRPFTYGLSTMLIHYIGASRIDRAKPSLRIMPLGGSVTYGSEST
DGNGYRRILQEILMSDGYNVKMVGSRKSGSMENNDNEGWRGFRIDQITNKAKISVPRFLP
NIFTVNAGSNDCVQNFEIETAGERMSDMLEYLWTASSGSTVVLSTLLPNLDREIEARVRR
ANEQFREMAKVKAAEGRKIIFVDIHGSDGPMISDLADGTHPNDVGYAKMAMIWRRSIHEA
VYKGFV

Enzyme Prediction     

No EC number prediction in CAP79838:RNA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE3	104	296	2.8e-57	0.9896907216494846

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238871	XynB_like	2.98e-47	104	297	1	157	SGNH_hydrolase subfamily, similar to Ruminococcus flavefaciens XynB. Most likely a secreted hydrolase with xylanase activity. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
404371	Lipase_GDSL_2	3.34e-18	109	288	2	176	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
238141	SGNH_hydrolase	1.59e-12	109	291	4	182	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
395531	Lipase_GDSL	2.27e-12	106	293	1	224	GDSL-like Lipase/Acylhydrolase.
238870	SGNH_hydrolase_like_1	5.81e-09	160	290	48	179	Members of the SGNH-hydrolase superfamily, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid. Myxobacterial members of this subfamily have been reported to be involved in adventurous gliding motility.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAP79838.1|CE0	4.14e-224	1	306	1	306
QYT04935.1|CE3	9.76e-84	103	306	51	254
UKZ86526.1|CE0	1.44e-82	107	306	1	200
QPG99528.1|CE3	1.10e-80	97	306	38	248
UKZ67969.1|CE0	1.27e-80	104	306	60	262

PDB Hits     

CAP79838:RNA-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9RLB8|CESA_RUMFL	4.36e-17	94	297	34	260	Multidomain esterase OS=Ruminococcus flavefaciens OX=1265 GN=cesA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000066	0.000000

TMHMM  Annotations     

There is no transmembrane helices in CAP79838:RNA-p1.