CAZyme Information: CAH02865.1

Basic Information

• Species: Kluyveromyces lactis
• Lineage: Ascomycota; Saccharomycetes; ; Saccharomycetaceae; Kluyveromyces; Kluyveromyces lactis
• CAZyme ID: CAH02865.1
• CAZy Family: GT71
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
412	CR382121|CGC2	47487.83	9.6794

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KlactisNRRLY-1140	5389	284590	313	5076

• Gene Location: location=CR382121:568689-569927(+)

Full Sequence      

MPFIPKNKKKWTKSFKVWISELKFYLHKRNKFSMLLLISVIIFLLYELTSSLPSKSSAGY
RIPKTHGMYQNEVQSSTPLIFPSVQDHGTLKELGVEGLFTLRIDVDGNREYVFKPEDTPM
TEAERKELAETDKKKFVKRTFLDHGKLVYKNKANHPEVVIVTIIDFENYSLDHIINTVQN
RVDYAQRHNYGTYVRWAQEFLPQVQKQSMEASYEFIKPLAVRAAMNAFPYAKYFWFFDQN
GLIMQLDTSLQQQLLEPKVLDAAVLKSVPVFEKSNIKTYKHFDAKTAKIIIPKTGAGKLD
TSSFVVTPSIHGKAFLDYINDPLVRNYPWPSSFTSAIGHLLQWHPRILKRTALVVPKTIA
SVYSPSAVKKQADDAERFNYMDGDFVITFTGCEASKTCEIELDKHYQLVKQD

Enzyme Prediction     

No EC number prediction in CAH02865.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT34	156	399	1.1e-68	0.983739837398374

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
368535	Glyco_transf_34	1.00e-60	156	398	3	238	galactosyl transferase GMA12/MNN10 family. This family contains a number of glycosyltransferase enzymes that contain a DXD motif. This family includes a number of C. elegans homologs where the DXD is replaced by DXH. Some members of this family are included in glycosyltransferase family 34.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAH02865.1|GT34	5.53e-303	1	412	1	412
QEU58505.1|GT34	1.46e-298	1	412	1	412
BAO37993.1|GT34	2.31e-209	1	410	1	407
QGN13850.1|GT34	2.31e-209	1	410	1	407
BAP69544.1|GT34	1.89e-208	1	410	1	407

PDB Hits     

CAH02865.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P46985|MNN11_YEAST	2.17e-130	18	411	21	421	Probable alpha-1,6-mannosyltransferase MNN11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNN11 PE=1 SV=2
sp|O13640|YGWH_SCHPO	3.13e-21	150	407	57	308	Uncharacterized alpha-1,2-galactosyltransferase C8D2.17 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pi048 PE=3 SV=2
sp|Q10359|GMH3_SCHPO	1.16e-18	144	409	72	331	Alpha-1,2-galactosyltransferase gmh3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gmh3 PE=3 SV=1
sp|O94622|YBKD_SCHPO	3.72e-17	155	411	98	352	Uncharacterized alpha-1,2-galactosyltransferase C1289.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1289.13c PE=3 SV=1
sp|Q09681|GMH2_SCHPO	3.97e-13	178	409	124	345	Probable alpha-1,2-galactosyltransferase gmh2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gmh2 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000022	0.000005

TMHMM  Annotations     

Start	End
32	54