CAZyme Information: CAH02728.1

Basic Information

• Species: Kluyveromyces lactis
• Lineage: Ascomycota; Saccharomycetes; ; Saccharomycetaceae; Kluyveromyces; Kluyveromyces lactis
• CAZyme ID: CAH02728.1
• CAZy Family: GT62
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
378		39275.90	4.1973

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KlactisNRRLY-1140	5389	284590	313	5076

• Gene Location: location=CR382121:287031-288167(-)

Full Sequence      

MRLNYVLSKTLALASVVSAAAVHKHHAAEEKRDVTVVVTNFVDQNGQVLVDGQTSATDAT
TTLQPVTDIGGGKSVETTTVTSSSGSSSSLSGSSTSSSGGTSSSSSSTSSSSDASSSSSG
EYGGALGITYSPYTSSGSCKSSDTIKSDIQNLSQFSVIRIYDTDCDAMEAILSQLQSGQK
IFVGIYDIDNIASSVSAIESAFNGDFSKVYAISVGNELINAGTSTVSQLSSAVESAKSKL
SAIGYTGDVVTVDTLVATENNSGLCSMSDFIAVNCHPYWDGNVEPSNCGPWVKQQLDNLS
STCNNGKKIIVTETGWPTKGDTYGSCVPSKSNQETCVQSIIDTLGSQAILFTTYNDYWKD
AGAQGVEQYWGIFGDSSV

Enzyme Prediction     

No EC number prediction in CAH02728.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	127	374	1.1e-29	0.9581993569131833

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	1.97e-75	124	373	44	301	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
366033	Glyco_hydro_17	3.63e-05	309	373	229	297	Glycosyl hydrolases family 17.
130673	235kDa-fam	7.48e-04	131	243	643	737	reticulocyte binding/rhoptry protein. This model represents a group of paralogous families in plasmodium species alternately annotated as reticulocyte binding protein, 235-kDa family protein and rhoptry protein. Rhoptry protein is localized on the cell surface and is extremely large (although apparently lacking in repeat structure) and is important for the process of invasion of the RBCs by the parasite. These proteins are found in P. falciparum, P. vivax and P. yoelii.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAH02728.1|GH17	9.73e-218	1	378	1	378
QEU58878.1|GH17	4.60e-216	1	378	1	378
BAP71385.1|GH17	2.34e-150	1	376	1	367
QGN15617.1|GH17	3.09e-150	1	376	1	375
BAO39903.2|GH17	8.11e-150	1	376	31	403

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	4.27e-09	127	374	39	283	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]
4WTR_A	2.46e-08	127	374	39	283	Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaribiose [Rhizomucor miehei CAU432],4WTS_A Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaritriose [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q04951|SCW10_YEAST	7.80e-77	124	372	135	385	Probable family 17 glucosidase SCW10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SCW10 PE=1 SV=1
sp|Q59XX2|MP65_CANAL	1.78e-75	123	373	124	376	Cell surface mannoprotein MP65 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MP65 PE=1 SV=3
sp|P53334|SCW4_YEAST	1.21e-71	124	372	132	382	Probable family 17 glucosidase SCW4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SCW4 PE=1 SV=1
sp|Q2US39|BTGE_ASPOR	7.67e-41	120	371	341	596	Probable beta-glucosidase btgE OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=btgE PE=3 SV=1
sp|B8MXP5|BTGE_ASPFN	7.67e-41	120	371	341	596	Probable beta-glucosidase btgE OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=btgE PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000767	0.999229	CS pos: 19-20. Pr: 0.9487

TMHMM  Annotations     

There is no transmembrane helices in CAH02728.1.