CAZyme Information: CAH02340.1

Basic Information

• Species: Kluyveromyces lactis
• Lineage: Ascomycota; Saccharomycetes; ; Saccharomycetaceae; Kluyveromyces; Kluyveromyces lactis
• CAZyme ID: CAH02340.1
• CAZy Family: GT48
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
447	CR382122|CGC4	51620.26	8.1154

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KlactisNRRLY-1140	5389	284590	313	5076

• Gene Location: location=CR382122:823945-825288(-)

Full Sequence      

MSVFGFDNIPTWLWWLLAIYLATPFVLYVVQPYLFYEGKSTKTRILIVVLGDLGHSPRIL
YHARSFSKAGFQVELSGYVDSDIPTDILDDDNIEIHGLKKYGSEKGLLVKALKQGLQLCS
MFWKLRAVDYILLQNPPTIPILPIAVVVKTFSRAKLIIDWHNLGYTILQMKFKDQFLHPL
VLLAYLIEWIFAKFANYHLTVTKAMKTYLVEKFGIDGKKIAVLYDRPGKQFSPLKEADDR
EALLKQEFIAKYIPKEFDISKDKIFVTSTSFTPDEDISVLIGSFKIYENSFQKFDQTLPR
ILCFITGKGPLQEKIVKQVQDFKWDRVQVEFLWLSSEDYPKLLRLCDYGVSLHTSSSGLD
LPMKILDMFGSGLPVICMNYPVLDELVQQNVNGLKFADRRELHEALIFSVKDEQVHQEIK
RGALRESKNRWNESWESALSELKIIHK

Enzyme Prediction     

EC	2.4.1.142:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT33	42	441	2.3e-144	0.9952941176470588

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340843	GT33_ALG1-like	0.0	40	442	1	410	chitobiosyldiphosphodolichol beta-mannosyltransferase and similar proteins. This family is most closely related to the GT33 family of glycosyltransferases. The yeast gene ALG1 has been shown to function as a mannosyltransferase that catalyzes the formation of dolichol pyrophosphate (Dol-PP)-GlcNAc2Man from GDP-Man and Dol-PP-Glc-NAc2, and participates in the formation of the lipid-linked precursor oligosaccharide for N-glycosylation. In humans ALG1 has been associated with the congenital disorders of glycosylation (CDG) designated as subtype CDG-Ik.
215155	PLN02275	1.74e-106	42	402	4	363	transferase, transferring glycosyl groups
223515	RfaB	2.68e-19	44	445	2	373	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
340825	GT4_WbuB-like	4.23e-18	44	438	1	386	Escherichia coli WbuB and similar proteins. This family is most closely related to the GT1 family of glycosyltransferases. WbuB in E. coli is involved in the biosynthesis of the O26 O-antigen. It has been proposed to function as an N-acetyl-L-fucosamine (L-FucNAc) transferase.
340831	GT4_PimA-like	5.83e-16	44	442	1	361	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAH02340.1|GT33	0.0	1	447	1	447
QEU61839.1|GT33	0.0	1	447	70	516
BAP73984.1|GT33	7.27e-258	1	447	1	451
BAO42603.1|GT33	7.65e-257	1	447	65	515
QGN17868.1|GT33	7.94e-257	1	447	66	516

PDB Hits     

CAH02340.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q6CVU2|ALG1_KLULA	0.0	1	447	1	447	Chitobiosyldiphosphodolichol beta-mannosyltransferase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 GN=ALG1 PE=3 SV=1
sp|P16661|ALG1_YEAST	5.99e-193	6	446	2	449	Chitobiosyldiphosphodolichol beta-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ALG1 PE=1 SV=1
sp|Q6FLZ2|ALG1_CANGA	4.59e-183	11	445	9	449	Chitobiosyldiphosphodolichol beta-mannosyltransferase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) OX=284593 GN=ALG1 PE=3 SV=1
sp|Q75BA5|ALG1_ASHGO	3.68e-175	7	445	27	468	Chitobiosyldiphosphodolichol beta-mannosyltransferase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=ALG1 PE=3 SV=2
sp|Q59Q79|ALG1_CANAL	4.05e-119	5	442	9	451	Chitobiosyldiphosphodolichol beta-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ALG1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000030	0.000000

TMHMM  Annotations     

Start	End
13	35