CAZyme Information: CAH01681.1

Basic Information

• Species: Kluyveromyces lactis
• Lineage: Ascomycota; Saccharomycetes; ; Saccharomycetaceae; Kluyveromyces; Kluyveromyces lactis
• CAZyme ID: CAH01681.1
• CAZy Family: GT2|GT2
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
555	CR382123|CGC3	59903.61	3.8822

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KlactisNRRLY-1140	5389	284590	313	5076

• Gene Location: location=CR382123:1217374-1219041(+)

Full Sequence      

MLFSKLVVASFASLLSKVVFADDLPAVEVYGSKFFYSNNGSQFYLKGIAYQADSANATSG
STIVDPLGDFDVCSRDIPYMEKVATNVIRVYALNTSLDHTECMQALNDAGIYVIADLAEP
SYSINRDSPKWNLELYERYTSVVDKFANYTNVLGFFAGNEVTNNSTNTDASPFVKAAIRD
TKQYIKDQGYRSIPVGYSSNDDADTRVAIADYFACGDDDVKADFYGINMYEWCGTSTFEE
SGYADRTDEFKNLTIPVFFSEYGCIEVRPRKFQDVAALYGENMTDVWSGGIVYMYFEEEN
NYGLVSVDGSSVSTLADYSYYSEEINSISPTYAQSASYTPTSTSLACPATGRYWKAATDL
PPTPNEDLCECMSSSLTCVVADDVDSDDYQALFDYICGEIDCTAITSNGTTGEYGSYSFC
NSKDQLSFVMNLYWIDQDQSSSACDFEGKASLKDEDPTVQSGCSAALSAIGTEGTGTYTG
SVTFTGGSSTSTSTGTRSSSSGSSSSSSNSSSSASSSSDSKDSSGVYKTNVPLYSVLTAC
VVTIFTVAGAGLIMI

Enzyme Prediction     

EC	2.4.1.-:30	2.4.1.-:33

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH72	22	327	1e-138	0.9871794871794872
CBM43	377	463	1.6e-24	0.9759036144578314

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397351	Glyco_hydro_72	2.04e-179	16	329	1	315	Glucanosyltransferase. This is a family of glycosylphosphatidylinositol-anchored beta(1-3)glucanosyltransferases. The active site residues in the Aspergillus fumigatus example are the two glutamate residues at 160 and 261.
400371	X8	1.36e-27	389	451	14	76	X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains.
197867	X8	3.31e-18	389	465	14	85	Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges.
397119	Glyco_hydro_2_C	2.12e-07	27	263	1	211	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAH01681.1|CBM43|GH72	0.0	1	555	1	555
QEU59643.1|CBM43|GH72	0.0	1	555	1	557
QGN17770.1|CBM43|GH72	1.84e-289	1	555	1	568
BAO42507.1|CBM43|GH72	1.84e-289	1	555	1	568
BAP73894.1|CBM43|GH72	1.23e-287	1	555	1	568

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2W62_A	1.44e-135	25	449	34	471	Saccharomyces cerevisiae Gas2p in complex with laminaripentaose [Saccharomyces cerevisiae],2W63_A Saccharomyces Cerevisiae Gas2p In Complex With Laminaritriose And Laminaritetraose [Saccharomyces cerevisiae],5O9O_A Crystal structure of ScGas2 in complex with compound 7. [Saccharomyces cerevisiae S288C],5O9P_A Crystal structure of Gas2 in complex with compound 10 [Saccharomyces cerevisiae S288C],5O9Q_A Crystal structure of ScGas2 in complex with compound 6 [Saccharomyces cerevisiae S288C],5O9R_A Crystal structure of ScGas2 in complex with compound 9 [Saccharomyces cerevisiae S288C],5O9Y_A Crystal structure of ScGas2 in complex with compound 11 [Saccharomyces cerevisiae S288C],5OA2_A Crystal structure of ScGas2 in complex with compound 8 [Saccharomyces cerevisiae S288C],5OA2_B Crystal structure of ScGas2 in complex with compound 8 [Saccharomyces cerevisiae S288C],5OA2_C Crystal structure of ScGas2 in complex with compound 8 [Saccharomyces cerevisiae S288C],5OA6_A Crystal structure of ScGas2 in complex with compound 12 [Saccharomyces cerevisiae S288C]
2W61_A	4.06e-135	25	449	34	471	Saccharomyces cerevisiae Gas2p apostructure (E176Q mutant) [Saccharomyces cerevisiae]
5FIH_A	4.06e-135	25	449	34	471	SACCHAROMYCES CEREVISIAE GAS2P (E176Q MUTANT) IN COMPLEX WITH LAMINARITETRAOSE AND LAMINARIPENTAOSE [Saccharomyces cerevisiae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P22146|GAS1_YEAST	5.48e-239	1	488	1	487	1,3-beta-glucanosyltransferase GAS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GAS1 PE=1 SV=2
sp|P56092|EPD1_CANMA	4.42e-221	11	482	7	480	Protein EPD1 OS=Candida maltosa OX=5479 GN=EPD1 PE=3 SV=1
sp|O13318|PHR2_CANAL	7.07e-214	19	482	20	480	pH-responsive protein 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PHR2 PE=2 SV=2
sp|P43076|PHR1_CANAL	1.01e-199	9	472	9	482	pH-responsive protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PHR1 PE=2 SV=4
sp|O74137|EPD2_CANMA	8.52e-199	5	466	7	477	Protein EPD2 OS=Candida maltosa OX=5479 GN=EPD2 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000273	0.999688	CS pos: 21-22. Pr: 0.9769

TMHMM  Annotations     

Start	End
531	553