CAZyme Information: CAH01679.1

Basic Information

• Species: Kluyveromyces lactis
• Lineage: Ascomycota; Saccharomycetes; ; Saccharomycetaceae; Kluyveromyces; Kluyveromyces lactis
• CAZyme ID: CAH01679.1
• CAZy Family: GT22
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
378	CR382123|CGC12	39276.26	4.2190

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KlactisNRRLY-1140	5389	284590	313	5076

• Gene Location: location=CR382123:1208373-1209509(-)

Full Sequence      

MLFTNLIAGASILGAAVASPIHGHKDNKRDLVYVTNRVTSTVVVYGDAPMTLAGASTTVA
LDADHIPTEATSPISYADVTRGDAAPTEAVSTTADAPESTSSTSSSTSSGSASSSSAASP
DFGSGFKGITYSPYTDGGACKSAQQVASDLASLSSYGVIRLYGVDCNQVENVFQGKASGQ
KLFLGVYFMDQIEAGVEQIASAVNSYGSWDDVVAVSIGNELVNSGASVDTVSSYVSTGRA
ALTSAGYTGPVVSVDTFTALIANPSLCDCNDFVAVNAHAYFDQNTAAEDAGSWLMNQIER
VWGTCNGNKQVVITESGWPSQGQTYGKAVPSKENQKIAIESIKKTCGDATILFTAFNDYW
KADGAWGVEKYWGVLSSE

Enzyme Prediction     

No EC number prediction in CAH01679.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	128	376	1e-24	0.9581993569131833

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	1.79e-103	120	378	39	304	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
366033	Glyco_hydro_17	2.66e-09	136	378	12	300	Glycosyl hydrolases family 17.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAH01679.1|GH17	3.42e-257	1	378	1	378
QEU59641.1|GH17	6.61e-255	1	378	1	378
BAO42509.1|GH17	2.86e-198	1	377	1	377
QGN17772.1|GH17	2.86e-198	1	377	1	377
BAP73896.1|GH17	2.86e-198	1	377	1	377

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	3.30e-08	126	378	37	285	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P53334|SCW4_YEAST	2.19e-125	122	378	129	386	Probable family 17 glucosidase SCW4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SCW4 PE=1 SV=1
sp|Q04951|SCW10_YEAST	1.82e-122	1	378	1	389	Probable family 17 glucosidase SCW10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SCW10 PE=1 SV=1
sp|Q59XX2|MP65_CANAL	6.66e-107	125	377	125	378	Cell surface mannoprotein MP65 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MP65 PE=1 SV=3
sp|B0Y9Q9|BTGE_ASPFC	2.23e-48	124	377	306	563	Probable beta-glucosidase btgE OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=btgE PE=3 SV=2
sp|Q4WC60|BTGE_ASPFU	2.23e-48	124	377	306	563	Probable beta-glucosidase btgE OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=btgE PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000309	0.999659	CS pos: 18-19. Pr: 0.9579

TMHMM  Annotations     

There is no transmembrane helices in CAH01679.1.