CAZyme Information: CAH00570.1

Basic Information

• Species: Kluyveromyces lactis
• Lineage: Ascomycota; Saccharomycetes; ; Saccharomycetaceae; Kluyveromyces; Kluyveromyces lactis
• CAZyme ID: CAH00570.1
• CAZy Family: GT15
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
748		82797.27	6.6042

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KlactisNRRLY-1140	5389	284590	313	5076

• Gene Location: location=CR382124:775848-778094(-)

Full Sequence      

MDSSHSTLTLHSNVSDWLSSPTSSSASPGPMGFGSGFFHQENDSVETITLDNRHRRVSNS
NKTVPYPETPRSGFGITHGCSNAGHSIDSFSNNSNSNNNDNNDDDKNNSNTNDSNDDNGD
DITKCISNLSVYDLLSSTQTASSSSENSSSDTSDGGSETDIEMDHSQKLAIKSALSVNNA
PVASTASSAITGKLYRQTSHPPIMRKLKSSLKLSSASSQSSISSSKSVRFASELTKVKRF
DSSREPVTISNETSPQVSPLDHESPNSRASSASTSYASNLVSNLDPSDSFWFGTQLSKMN
LPLSKSIPKFSLSDSDNDLDDSDSDFDVDYLNDQLNNNYHYMPSNNSKFSSNNNSNSNSV
PSSSSNSNTFSHNSFKFRMNGSNDTMTDYDFNNNSNSFNKENINHQNGFNFNFNTSPTKD
PIQIKSWILKGTNIKKFYPTSLDINQDLSKYLQGNNIKLHECNSLQLSQGKLTGLIYVNN
LSFEKFIEIKFSFNGWKDIHYVTANFKRTITDTVDEFQFLINLSSFVYFLKVKNLILFNS
LISPLTIQLCCRYDVNGETYYDNNNYENYQVSLDAITNLKQKSKKKSNRHRLLKSSSIMK
RSLSSDNFTTDGNYKFASLSPVPSSVDHTKLVPPKLGRRFSEDTDFFNSSPLKNVSPNYT
TTPLNQKDPKYDELIKSYCFYDPNSAAASSSDKSNRSMTTETVPTSDTNSTTNSTGSPAF
LNSNLPSENCIPSKRDSPKLDTMKSSKC

Enzyme Prediction     

No EC number prediction in CAH00570.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM21	455	571	2e-28	0.9719626168224299

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397445	CBM_21	1.69e-27	451	559	1	100	Carbohydrate/starch-binding module (family 21). This family consists of several eukaryotic proteins that are thought to be involved in the regulation of glycogen metabolism. For instance, the mouse PTG protein has been shown to interact with glycogen synthase, phosphorylase kinase, phosphorylase a: these three enzymes have key roles in the regulation of glycogen metabolism. PTG also binds the catalytic subunit of protein phosphatase 1 (PP1C) and localizes it to glycogen. Subsets of similar interactions have been observed with several other members of this family, such as the yeast PIG1, PIG2, GAC1 and GIP2 proteins. While the precise function of these proteins is not known, they may serve a scaffold function, bringing together the key enzymes in glycogen metabolism. This family is a carbohydrate binding domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAH00570.1|CBM21	0.0	1	748	1	748
QEU60698.1|CBM21	0.0	1	748	1	748
BAP70681.1|CBM21	6.28e-248	1	691	1	713
QGN14890.1|CBM21	6.28e-248	1	691	1	713
BAO39162.1|CBM21	6.28e-248	1	691	1	713

PDB Hits     

CAH00570.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P28006|GAC1_YEAST	4.63e-49	189	667	26	441	Serine/threonine-protein phosphatase 1 regulatory subunit GAC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GAC1 PE=1 SV=2
sp|Q06216|PIG1_YEAST	7.46e-29	419	653	156	394	Serine/threonine-protein phosphatase 1 regulatory subunit PIG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PIG1 PE=1 SV=1
sp|Q0VCR4|PPR3C_BOVIN	2.29e-07	442	571	136	256	Protein phosphatase 1 regulatory subunit 3C OS=Bos taurus OX=9913 GN=PPP1R3C PE=2 SV=1
sp|Q9UQK1|PPR3C_HUMAN	7.16e-07	442	571	136	256	Protein phosphatase 1 regulatory subunit 3C OS=Homo sapiens OX=9606 GN=PPP1R3C PE=1 SV=2
sp|Q6P950|PR3CB_DANRE	1.69e-06	430	571	131	257	Protein phosphatase 1 regulatory subunit 3C-B OS=Danio rerio OX=7955 GN=ppp1r3cb PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000059	0.000000

TMHMM  Annotations     

There is no transmembrane helices in CAH00570.1.