CAZyme Information: CAH00522.1

Basic Information

• Species: Kluyveromyces lactis
• Lineage: Ascomycota; Saccharomycetes; ; Saccharomycetaceae; Kluyveromyces; Kluyveromyces lactis
• CAZyme ID: CAH00522.1
• CAZy Family: GT76
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
456	CR382124|CGC2	49204.63	4.4042

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KlactisNRRLY-1140	5389	284590	313	5076

• Gene Location: location=CR382124:698125-699495(+)

Full Sequence      

MVEYTFTWPKGPQEVVVTGNFDNWTGSLPLVKQPSGDFSLTMPLPPNDDDKFVFKFIVDG
EWVVSDKYEKDSSAGPINNVIYTSKIVGTTTGSTFIPESALSAKTSQKPKSQPAPGSNKK
GKKKKVKVKKRIRKDKRTGEQTVISEERTELNSDGEEESEEVSTTATNSKEVTPLPPQTA
TTEPADDEEATAPVPAVLPSKENQQTTLGEPGIAIVPNPNEIAAFKEVRNVDAQKLNEQL
NAELKEKEADKKETLDQQAEETAAVTAAATAAAAENPTDDVAPVIQSATEPAVQTEQLEQ
EKAVAEPETVPTQDATIPNTHIESQVTDGSDVVEEVGIITSPEQEAELVQRTLDPKIGGE
AELLIAEGEVPKDSIPAVQEQVEKIADEAIEANTKIADNVTEDVKKTAEEAKTTTNNAAN
KVTNNATSTNTPTKTAAKPEKKKKKGFFSKLKKIFN

Enzyme Prediction     

No EC number prediction in CAH00522.1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
199889	E_set_AMPKbeta_like_N	1.26e-24	3	81	1	78	N-terminal Early set domain, a glycogen binding domain, associated with the catalytic domain of AMP-activated protein kinase beta subunit. E or "early" set domains are associated with the catalytic domain of AMP-activated protein kinase beta subunit glycogen binding domain at the N-terminal end. AMPK is a metabolic stress sensing protein that senses AMP/ATP and has recently been found to act as a glycogen sensor as well. The protein functions as an alpha-beta-gamma heterotrimer. This N-terminal domain is the glycogen binding domain of the beta subunit. This domain is also a member of the CBM48 (Carbohydrate Binding Module 48) family whose members include pullulanase, maltooligosyl trehalose synthase, starch branching enzyme, glycogen branching enzyme, glycogen debranching enzyme, and isoamylase.
406865	AMPK1_CBM	1.50e-17	5	85	4	81	Glycogen recognition site of AMP-activated protein kinase. AMPK1_CBM is a family found in close association with AMPKBI pfam04739. The surface of AMPK1_CBM reveals a carbohydrate-binding pocket.
199892	E_set_Isoamylase_like_N	3.63e-12	2	81	1	84	N-terminal Early set domain associated with the catalytic domain of isoamylase-like (also called glycogen 6-glucanohydrolase) proteins. E or "early" set domains are associated with the catalytic domain of isoamylase-like proteins at the N-terminal end. Isoamylase is one of the starch-debranching enzymes that catalyze the hydrolysis of alpha-1,6-glucosidic linkages specific in alpha-glucans such as amylopectin or glycogen. Isoamylase contains a bound calcium ion, but this is not in the same position as the conserved calcium ion that has been reported in other alpha-amylase family enzymes. The N-terminal domain of isoamylase may be related to the immunoglobulin and/or fibronectin type III superfamilies. These domains are associated with different types of catalytic domains at either the N-terminal or C-terminal end and may be involved in homodimeric/tetrameric/dodecameric interactions. Members of this family include members of the alpha amylase family, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase. This domain is also a member of the CBM48 (Carbohydrate Binding Module 48) family whose members include pullulanase, maltooligosyl trehalose synthase, starch branching enzyme, glycogen branching enzyme, glycogen debranching enzyme, and the beta subunit of AMP-activated protein kinase.
236766	rne	0.009	281	433	847	995	ribonuclease E; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAH00522.1|CBM48	6.48e-260	1	456	1	456
QEU60655.1|CBM48	4.59e-253	1	456	1	456
QGN14931.1|CBM48	4.32e-108	1	240	1	243
BAO39207.1|CBM48	5.69e-108	1	240	1	243
BAP70723.1|CBM48	5.87e-108	1	240	1	243

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2F15_A	2.88e-09	8	85	16	90	Glycogen-Binding Domain Of The Amp-Activated Protein Kinase beta2 Subunit [Homo sapiens]
2LU3_A	3.60e-09	8	85	24	98	Solution NMR structure of the apo-form of the beta2 carbohydrate module of AMP-activated protein kinase [Rattus norvegicus],2LU4_A Solution NMR structure of the beta2 carbohydrate module of AMP-activated protein kinase bound to glucosyl-cyclodextrin [Rattus norvegicus]
4Y0G_A	6.33e-09	8	82	17	88	beta2 carbohydrate binding module (CBM) of AMP-activated protein kinase (AMPK) [Rattus norvegicus],4Y0G_B beta2 carbohydrate binding module (CBM) of AMP-activated protein kinase (AMPK) [Rattus norvegicus],4YEE_A beta2 carbohydrate binding module (CBM) of AMP-activated protein kinase (AMPK) in complex with glucosyl-beta-cyclodextrin [Rattus norvegicus],4YEE_B beta2 carbohydrate binding module (CBM) of AMP-activated protein kinase (AMPK) in complex with glucosyl-beta-cyclodextrin [Rattus norvegicus],4YEE_C beta2 carbohydrate binding module (CBM) of AMP-activated protein kinase (AMPK) in complex with glucosyl-beta-cyclodextrin [Rattus norvegicus],4YEE_D beta2 carbohydrate binding module (CBM) of AMP-activated protein kinase (AMPK) in complex with glucosyl-beta-cyclodextrin [Rattus norvegicus],4YEE_E beta2 carbohydrate binding module (CBM) of AMP-activated protein kinase (AMPK) in complex with glucosyl-beta-cyclodextrin [Rattus norvegicus],4YEE_F beta2 carbohydrate binding module (CBM) of AMP-activated protein kinase (AMPK) in complex with glucosyl-beta-cyclodextrin [Rattus norvegicus],4YEE_G beta2 carbohydrate binding module (CBM) of AMP-activated protein kinase (AMPK) in complex with glucosyl-beta-cyclodextrin [Rattus norvegicus],4YEE_H beta2 carbohydrate binding module (CBM) of AMP-activated protein kinase (AMPK) in complex with glucosyl-beta-cyclodextrin [Rattus norvegicus],4YEE_I beta2 carbohydrate binding module (CBM) of AMP-activated protein kinase (AMPK) in complex with glucosyl-beta-cyclodextrin [Rattus norvegicus],4YEE_J beta2 carbohydrate binding module (CBM) of AMP-activated protein kinase (AMPK) in complex with glucosyl-beta-cyclodextrin [Rattus norvegicus],4YEE_K beta2 carbohydrate binding module (CBM) of AMP-activated protein kinase (AMPK) in complex with glucosyl-beta-cyclodextrin [Rattus norvegicus],4YEE_L beta2 carbohydrate binding module (CBM) of AMP-activated protein kinase (AMPK) in complex with glucosyl-beta-cyclodextrin [Rattus norvegicus],4YEE_M beta2 carbohydrate binding module (CBM) of AMP-activated protein kinase (AMPK) in complex with glucosyl-beta-cyclodextrin [Rattus norvegicus],4YEE_N beta2 carbohydrate binding module (CBM) of AMP-activated protein kinase (AMPK) in complex with glucosyl-beta-cyclodextrin [Rattus norvegicus],4YEE_O beta2 carbohydrate binding module (CBM) of AMP-activated protein kinase (AMPK) in complex with glucosyl-beta-cyclodextrin [Rattus norvegicus],4YEE_P beta2 carbohydrate binding module (CBM) of AMP-activated protein kinase (AMPK) in complex with glucosyl-beta-cyclodextrin [Rattus norvegicus],4YEE_Q beta2 carbohydrate binding module (CBM) of AMP-activated protein kinase (AMPK) in complex with glucosyl-beta-cyclodextrin [Rattus norvegicus],4YEE_R beta2 carbohydrate binding module (CBM) of AMP-activated protein kinase (AMPK) in complex with glucosyl-beta-cyclodextrin [Rattus norvegicus]
4REW_B	2.20e-08	8	85	8	82	Crystal structure of the non-phosphorylated human alpha1 beta2 gamma1 holo-AMPK complex [Homo sapiens]
7JHG_B	2.24e-08	8	85	9	83	Chain B, 5'-AMP-activated protein kinase subunit beta-2 [Homo sapiens],7JHH_B Chain B, 5'-AMP-activated protein kinase subunit beta-2 [Homo sapiens],7JIJ_B Chain B, 5'-AMP-activated protein kinase subunit beta-2 [Homo sapiens],7M74_B Chain B, 5'-AMP-activated protein kinase subunit beta-2 [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P53885|MDG1_YEAST	2.20e-25	3	168	7	173	Signal transduction protein MDG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MDG1 PE=1 SV=1
sp|C7GTE8|MDG1_YEAS2	2.20e-25	3	168	7	173	Signal transduction protein MDG1 OS=Saccharomyces cerevisiae (strain JAY291) OX=574961 GN=MDG1 PE=3 SV=1
sp|C8ZG55|MDG1_YEAS8	2.20e-25	3	168	7	173	Signal transduction protein MDG1 OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) OX=643680 GN=MDG1 PE=3 SV=1
sp|B3LP25|MDG1_YEAS1	4.10e-25	3	168	7	173	Signal transduction protein MDG1 OS=Saccharomyces cerevisiae (strain RM11-1a) OX=285006 GN=MDG1 PE=3 SV=1
sp|A6ZT54|CRP1_YEAS7	5.09e-25	1	240	6	248	Cruciform DNA-recognizing protein 1 OS=Saccharomyces cerevisiae (strain YJM789) OX=307796 GN=CRP1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000052	0.000000

TMHMM  Annotations     

There is no transmembrane helices in CAH00522.1.