CAZyme Information: CAH00182.1

Basic Information

• Species: Kluyveromyces lactis
• Lineage: Ascomycota; Saccharomycetes; ; Saccharomycetaceae; Kluyveromyces; Kluyveromyces lactis
• CAZyme ID: CAH00182.1
• CAZy Family: GH76
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
765	CR382124|CGC1	84415.34	5.1854

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KlactisNRRLY-1140	5389	284590	313	5076

• Gene Location: location=CR382124:26976-29273(-)

Full Sequence      

MIMSKFDVEQKLSELTRDEKISLLSATDFWHTKEIERLGIPSVRVSDGPNGIRGTRFFDS
VPSGCFPNGTGLASTFDEELLKEAGKLMAKEAVAKNAAVILGPTTNMQRGPLGGRGFESF
SEDPYLAGVATASVVQGIQSEGIAATVKHFVCNDLEDQRFSSNSILSERALREIYLEPFR
LAIKNSDPVCLMTALNKVNGEHCPQNKKLLIELLRKEWSWDGMIMSDWFATYTTAASIKN
GLDIEFPGPTRWRTNELVSHSLNSREQISIHDVDDRVRQVLKMIKFVVDNQEKTGIVQNG
PETTSNNSKETAELLRKIAADSIVLLKNENSVLPLKKEESIVIIGPNAKAKVSSGGGSAS
LHSYYVISPYEGIVNKVGKEVPYTLGAESHKTLSNLIEQLVVDPSKPAEGDNVGAAAYFY
NEPAGARPQGKSPFHVTTFKHSHNMLFDFKHEKIDSSNPLFYITLEGYFTPKEDANYLFG
LQVYGTGILYLDDELVVDQKKDQTRGSFCFGAGTDEKTKTVSLQKGKAYKVRIEYGSGPT
SELVSEFGSGGFQVGVAKAIDADEEIRKAAKLAAGHDKAILCIGLNAEWESEGHDREDMI
LPGRTNDLVRAVLEANPNTVIINQSGTPVEFPWVEQANALLQAWYGGNELGNAIADVLYG
DVVPGGKLSLSWPLKLEDNPTYLNFKTEFGRVLYGEDIFIGYRFYEKLQRRVAFPFGYGL
SYTEFALSHLQVQTDEEVISVSVNVKNTGEEYAGIRSRTNLHCCD

Enzyme Prediction     

EC	3.2.1.21:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	33	246	5.1e-60	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	3.07e-66	27	383	47	393	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
185053	PRK15098	7.19e-54	37	754	101	683	beta-glucosidase BglX.
396478	Glyco_hydro_3_C	1.28e-53	323	702	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
178629	PLN03080	2.69e-40	12	731	57	642	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	8.63e-35	33	281	59	314	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAH00182.1|GH3	0.0	1	765	1	765
ACF93471.1|GH3|3.2.1.21	0.0	1	754	1	754
QEU60335.1|GH3	0.0	1	754	1	754
QEU61608.1|GH3	0.0	3	754	1	752
CAG99696.1|GH3	0.0	3	754	1	752

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3ABZ_A	0.0	4	754	2	752	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
3AC0_A	0.0	3	754	1	752	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
7MS2_A	8.05e-121	7	750	4	582	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	2.82e-91	12	750	9	577	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	3.02e-78	8	749	4	627	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P07337|BGLS_KLUMA	0.0	3	754	1	752	Beta-glucosidase OS=Kluyveromyces marxianus OX=4911 PE=3 SV=1
sp|A1CA51|BGLI_ASPCL	1.14e-257	3	750	1	743	Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglI PE=3 SV=1
sp|Q4WU49|BGLI_ASPFU	1.10e-252	3	749	1	742	Probable beta-glucosidase I OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglI PE=3 SV=1
sp|B0Y3M6|BGLI_ASPFC	1.10e-252	3	749	1	742	Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglI PE=3 SV=1
sp|A1DFA8|BGLI_NEOFI	2.21e-252	3	749	1	742	Probable beta-glucosidase I OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000052	0.000002

TMHMM  Annotations     

There is no transmembrane helices in CAH00182.1.