CAZyme Information: CAH00166.1

Basic Information

• Species: Kluyveromyces lactis
• Lineage: Ascomycota; Saccharomycetes; ; Saccharomycetaceae; Kluyveromyces; Kluyveromyces lactis
• CAZyme ID: CAH00166.1
• CAZy Family: GH72|CBM43
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
630		69008.97	5.2766

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KlactisNRRLY-1140	5389	284590	313	5076

• Gene Location: location=CR382125:2222708-2224600(+)

Full Sequence      

MSKFDIEQTLGKLTRDEKISLLSAVDFWHTKEIERLGIPSVRVSDGPNGIRGTRFFDSVP
SGCFPNGTGLASTFDEELLKEAGKLMGKEAVAKNAAVILGPTANMQRGPLGGRGFESFSE
DPYLAGVATASVVQGIQSEGIAATVKHFVCNDLEDQRFSSNATLSERALREIYLEPFRLA
VKNADPVCLMSAYNKVNGEHCSQNKKLLLDILRKEWNWDGMIMSDWFGTYTTAASIKNGL
DIEFPGPTRWRTNELVSHSLNSREQISIYDVDDRVRQVLKMIKFVLDNQEKTGIVQNGPE
TTSNNSKETSELLRKIAADSIVLLKNENSILPLKKEESVVVIGPNAKAKASSGGGSASMN
SYYVISPYEGIVKKVGKEVPYTIGAESHKTLSNLIEQLVVDPSKPAEGDNAGATGFFYSE
PVEKRAKDESPFHVAAFKHSFNLLFDFKHDKIDTNNPLFYITLEGYFTPEEDANYIFGLQ
VYGTGLLYLDEELLIDQKKGQTRGGFCFGAGTNEKTKTVTLQKGKSYKVRIEYGSGPTSQ
LVSEFGAGALQVGVAKAIDADEEIKKAAKLAAGHDKAILCIGLNAEWESEGHDREDMTLP
GRTNDLVRAVLEANPNTVIVNQSGTPVEFP

Enzyme Prediction     

EC	3.2.1.21:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	31	244	6.6e-63	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	3.50e-69	26	381	48	393	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
395747	Glyco_hydro_3	1.20e-37	31	279	59	314	Glycosyl hydrolase family 3 N terminal domain.
185053	PRK15098	3.23e-35	35	407	101	490	beta-glucosidase BglX.
178629	PLN03080	5.90e-31	13	355	60	439	Probable beta-xylosidase; Provisional
396478	Glyco_hydro_3_C	9.59e-26	321	628	1	145	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAH00166.1|GH3	0.0	1	630	1	630
QEU61154.1|GH3	0.0	1	630	1	630
QEU61608.1|GH3	0.0	1	630	1	630
CAG99696.1|GH3	0.0	1	630	1	630
ACF93471.1|GH3|3.2.1.21	0.0	1	630	3	632

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3ABZ_A	0.0	2	630	2	630	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
3AC0_A	0.0	1	630	1	630	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
7MS2_A	7.20e-86	5	416	4	410	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	2.64e-70	9	357	8	352	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	1.12e-60	6	398	4	407	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P07337|BGLS_KLUMA	0.0	1	630	1	630	Beta-glucosidase OS=Kluyveromyces marxianus OX=4911 PE=3 SV=1
sp|A1CA51|BGLI_ASPCL	1.60e-201	1	630	1	617	Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglI PE=3 SV=1
sp|A1DFA8|BGLI_NEOFI	1.45e-199	1	630	1	617	Probable beta-glucosidase I OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglI PE=3 SV=1
sp|Q4WU49|BGLI_ASPFU	1.16e-198	1	630	1	617	Probable beta-glucosidase I OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglI PE=3 SV=1
sp|B0Y3M6|BGLI_ASPFC	1.16e-198	1	630	1	617	Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000039	0.000004

TMHMM  Annotations     

There is no transmembrane helices in CAH00166.1.