CAZyme Information: CAGL0M07315g-T-p1

Basic Information

• Species: [Candida] glabrata
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; [Candida] glabrata
• CAZyme ID: CAGL0M07315g-T-p1
• CAZy Family: GT71
• CAZyme Description: Ortholog(s) have mannosyltransferase activity and role in glycosphingolipid biosynthetic process, mannosyl-inositol phosphorylceramide metabolic process, sphingolipid biosynthetic process

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
362	ChrM_C_glabrata_CBS138|CGC4	42706.10	9.0578

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CglabrataCBS138	5615	284593	322	5293

• Gene Location: location=ChrM_C_glabrata_CBS138:740469-741557(-)

Full Sequence      

MKREVAYLAITNAFLVFFILFYTFDLLTLCIDDTIHDTLTASDLNSSVPREDELIPRIIH
QTYKTEDIPKHWIEGQHRCQELHSDYQYIMWTDQMALDFITEHYSWFLPTFVGYKRPIQR
ADAIRYFILYHYGGIYIDLDDKCERPLDNLLKLPAFVRKTSPLGISNDVMGSMPGHPFFW
KAIHNLNHYNKNWYVPYLTIMSSTGPLFISIVWKHYRRWKIFTKNYVPVKIIQPQDYKGS
SSSFFSIVKGSSWHTDDAKWMKSLENHILSCVVAGFIFAFFILYGEYIFYCWLCYKKPIT
LTNSDSGSKNSWSSKLLWVWNRIKFRSSSYTTTYPTTPTTSPKRSRKDSNAVFDIEKRTV
NV

Enzyme Prediction     

EC	2.4.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	75	151	4.9e-21	0.9

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	3.10e-85	1	294	10	319	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	5.68e-23	69	151	1	87	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAG62642.1|GT32	1.54e-270	1	362	1	362
QHS69351.1|GT32	1.54e-270	1	362	1	362
UCS34123.1|GT32	1.54e-270	1	362	1	362
UCS39353.1|GT32	1.54e-270	1	362	1	362
UCS23663.1|GT32	1.54e-270	1	362	1	362

PDB Hits     

CAGL0M07315g-T-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P33300|SUR1_YEAST	5.07e-151	1	357	1	369	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|P38287|CSH1_YEAST	4.02e-139	1	354	1	359	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|Q9UT67|IMT2_SCHPO	1.02e-79	44	284	54	312	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1
sp|Q10323|IMT3_SCHPO	2.47e-71	55	284	57	285	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|O14084|IMT1_SCHPO	1.27e-64	38	284	45	292	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.997416	0.002621

TMHMM  Annotations     

Start	End
5	27
194	216
268	290