CAZyme Information: CAGL0J11506g-T-p1

Basic Information

• Species: [Candida] glabrata
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; [Candida] glabrata
• CAZyme ID: CAGL0J11506g-T-p1
• CAZy Family: GT3
• CAZyme Description: Ortholog(s) have chitin synthase activity, role in ascospore wall chitin biosynthetic process, septum digestion after cytokinesis and chitosome, plasma membrane localization

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1164	ChrJ_C_glabrata_CBS138|CGC2	132982.70	6.1795

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CglabrataCBS138	5615	284593	322	5293

• Gene Location: location=ChrJ_C_glabrata_CBS138:1115691-1119185(-)

Full Sequence      

MSYQYGSGGSYGYNGYSGQGNGNSGNYNNNNSSYNNNNSNRQSRHPYVSDSIPEEEAQSY
EMHDVAQGVANDGYGNVGTMHSNPMYRNFVNTNSRGRPAPPPQEYTDVFVNTDLNYRNNS
FTDHNQEHSLVTPTTNGPSINIIQNTPELIHGTTSSSILASQTGNSTTHYFNEEDYYYNN
NIIRTEDDINNGDRVNSSYLNTQSGVTPVISDTPSIISNSEDTRPILNNPVGNEPSFNNH
YGYNNNYNNYEQNATHPYYGGEVPNGDIENSYVDPNGDDYQINSYLGKNGEMIDPYEVDE
DQYGYGHRSGRELLSVDYMKNKKYDAVTSNRELPEAEGEYSYGDGEDGDLSSGSVISGYA
HEDLADLDTNTIDKIKSLNTSFTSSMGSRDMLINQEESFKKRSLKRAGTQVRKFKLWKGN
FVFDSPISRSLLNQYQSGIDKNNDLSNEFKFMRYQAVTCEPNVLAQQNFTVRQLRYLNPR
STELLIVITMYNEDHILLGRTLKGVMDNIKHMVKKTRSSTWGPDAWKKIVVCIVSDGRAK
INEKSLALLSSLGCYQDGFAKDEINGKKVVTHVYEHTTMMNVVDVTDDNVELRCDQSTVP
IQMLFCLKEQNQKKINSHRWAFEGFAELLRPNIVTLLDAGTMPGKDSIYELWREFRNPQV
GGACGEIRTDLGKNYSNLINPLIASQNFEYKMSNILDKTTESNFGFITVLPGAFSAYRLE
AVQGLPLQKYFYGESMEHEEKFHFFSSNMYLAEDRILCFEVVMKKNANWILKYSRSSHAT
TDVPDRVPEFILQRRRWLNGSFFASVYSFCHFYRIWTSGHNIFRKCFLMIEFLYLFFNTL
LSWFSLSSYFLVFRILTLSIATTYKSVFGVLSVVFLWLYGVCLLSTFILSLGNKPKSTEL
YYVVTFIFFAVLMIYMMFCSVFMSVKSFENLLKEDHITFHGLFTQETFRDMVISLGSTVC
LYIASSVIYLQPWHMLTSFVQYLLLSPSYVNVLNIYAFCNVHDLSWGTKGSASKPLGKIT
SKEDGTFKMEILVSSAEIEANYEKYKKMLYEQPNEEDSKPELSPEEKKTGYYANVRSLVI
IFWVMTNFAICAVVLETGGIGDYLTLKTMNKQHTEQIQPRPLLSNKASIYFAIILWLVAL
SAVIRFFGCTIYMISRFFKRLRHW

Enzyme Prediction     

EC	2.4.1.16:26	2.4.1.16:26

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	490	655	1.4e-71	0.9938650306748467
GT2	633	827	4.4e-16	0.36622390891840606

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396286	Chitin_synth_1	1.87e-97	490	655	1	163	Chitin synthase. This region is found commonly in chitin synthases classes I, II and III. Chitin a linear homopolymer of GlcNAc residues, it is an important component of the cell wall of fungi and is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases.
133033	Chitin_synth_C	3.47e-76	486	804	1	244	C-terminal domain of Chitin Synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin. Chitin synthase, also called UDP-N-acetyl-D-glucosamine:chitin 4-beta-N-acetylglucosaminyltransferase, catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of GlcNAc residues formed by covalent beta-1,4 linkages. Chitin is an important component of the cell wall of fungi and bacteria and it is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases. Studies with fungi have revealed that most of them contain more than one chitin synthase gene. At least five subclasses of chitin synthases have been identified.
224136	BcsA	4.47e-34	582	919	90	407	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
400626	Chitin_synth_1N	3.25e-30	413	489	1	70	Chitin synthase N-terminal. This is the N-terminal domain of Chitin synthase (pfam01644).
133045	CESA_like	1.83e-16	603	722	55	166	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QHS67865.1|GT2	0.0	1	1164	1	1164
CAG61164.1|GT2	0.0	1	1164	1	1164
UCS37700.1|GT2	0.0	1	1164	1	1164
UCS22010.1|GT2	0.0	1	1164	1	1164
UCS32471.1|GT2	0.0	1	1164	1	1164

PDB Hits     

CAGL0J11506g-T-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P08004|CHS1_YEAST	0.0	46	1161	58	1128	Chitin synthase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CHS1 PE=1 SV=2
sp|P30572|CHS2_CANAX	1.44e-247	257	1162	66	1002	Chitin synthase 2 OS=Candida albicans OX=5476 GN=CHS2 PE=2 SV=2
sp|P30583|CHSC_EMENI	3.55e-231	411	1159	177	916	Chitin synthase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=chsC PE=3 SV=3
sp|P30588|CHS3_NEUCR	3.51e-222	411	1159	150	886	Chitin synthase 3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=chs-3 PE=3 SV=2
sp|Q12564|CHSA_AMPQU	1.10e-220	411	1156	163	897	Chitin synthase A OS=Ampelomyces quisqualis OX=50730 GN=CHSA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000026	0.000001

TMHMM  Annotations     

Start	End
833	855
868	890
900	922
952	974
979	1001
1078	1100
1127	1149