CAZyme Information: CAGL0J08910g-T-p1

Basic Information

• Species: [Candida] glabrata
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; [Candida] glabrata
• CAZyme ID: CAGL0J08910g-T-p1
• CAZy Family: GT24
• CAZyme Description: Has domain(s) with predicted hydrolase activity, hydrolyzing O-glycosyl compounds activity and role in carbohydrate metabolic process

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
494	ChrJ_C_glabrata_CBS138|CGC5	56466.29	7.1338

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CglabrataCBS138	5615	284593	322	5293

• Gene Location: location=ChrJ_C_glabrata_CBS138:879267-880751(-)

Full Sequence      

MAKQLKLLIIIRFLLSINFSRGIDLHKPETPVRCSIRDGSCPAEWPCCSPYGVCGSGPTC
IGGCNPQYSFREDSCVPSPVLIPYNAIEFSTEGTKLIRIASGNLQKGDAFLKKGARMKER
EMELKRNKMIHFSDFLITEDATEANKMLMDYDFIYSGMTQMDPTTSEIQLTMPKRSTGSL
VASVRSFLYGKVSVTMKTARSGGVITALVLMSAVGDELDFEFVGSELNQVQTNHYYQGEL
DFTKMKKHEIKDNTWLNYHNFEIFWTEDKVDWVIDGVVVRTLYKKDTWDPNAKVYKFPDS
PMRLEIAIWPGGSEKNEIGTIMWAGGLVDWDNPPDMLEKGYFSANVKVIRIEPSANRHLP
RIYHCLTRKSHKDINDLTSRDLSMATFYYNSSRDNRYNENSLEWDCFNDIYLSNSSSSGT
DLYYGNKGKQTNSLEKSPNSEYSNENDSEEINVEEWYRRSMMFRPKRQKSSAAHKTKSST
LPLIIFLIISLFIK

Enzyme Prediction     

No EC number prediction in CAGL0J08910g-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	161	329	3.4e-73	0.9655172413793104

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185692	GH16_fungal_CRH1_transglycosylase	7.57e-97	142	353	1	201	glycosylphosphatidylinositol-glucanosyltransferase. Group of fungal GH16 members related to Saccharomyces cerevisiae Crh1p. Chr1p and Crh2p are transglycosylases that are required for the linkage of chitin to beta(1-3)glucose branches of beta(1-6)glucan, an important step in the assembly of new cell wall. Both have been shown to be glycosylphosphatidylinositol (GPI)-anchored. A third homologous protein, Crr1p, functions in the formation of the spore wall. They belongs to the family 16 of glycosyl hydrolases that includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
395585	Glyco_hydro_16	1.26e-54	167	325	12	168	Glycosyl hydrolases family 16.
211314	ChtBD1_GH16	1.26e-27	32	79	1	47	Hevein or Type 1 chitin binding domain subfamily that co-occurs with family 16 glycosyl hydrolases. This subfamily includes Saccharomyces cerevisiae Utr2p, also known as Crh2p, which participates in the cross-linking of chitin to beta(1-3)- and beta(1-6) glucan in the cell wall, and S. cerevisiae Crr1p, a putative transglycosidase which is needed for proper spore wall assembly. ChtBD1 is a lectin domain found in proteins from plants and fungi that bind N-acetylglucosamine, plant endochitinases, wound-induced proteins, and the alpha subunit of Kluyveromyces lactis killer toxin. This domain is involved in the recognition and/or binding of chitin subunits; it typically occurs N-terminal to glycosyl hydrolase domains in chitinases, together with other carbohydrate-binding domains, or by itself in tandem-repeat arrangements.
225182	BglS	1.08e-23	176	421	104	352	Beta-glucanase, GH16 family [Carbohydrate transport and metabolism].
185685	GH16_XET	1.04e-18	159	334	19	190	Xyloglucan endotransglycosylase, member of glycosyl hydrolase family 16. Xyloglucan endotransglycosylases (XETs) cleave and religate xyloglucan polymers in plant cell walls via a transglycosylation mechanism. Xyloglucan is a soluble hemicellulose with a backbone of beta-1,4-linked glucose units, partially substituted with alpha-1,6-linked xylopyranose branches. It binds noncovalently to cellulose, cross-linking the adjacent cellulose microfibrils, giving it a key structural role as a matrix polymer. Therefore, XET plays an important role in all plant processes that require cell wall remodeling.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAG61047.1|CBM18|GH16_19	0.0	1	494	1	494
QHS67749.1|CBM18|GH16_19	0.0	1	494	1	494
QNG15258.1|CBM18|GH16_19	0.0	1	494	1	494
UCS37584.1|CBM18|GH16_19	0.0	1	494	1	494
UCS32355.1|CBM18|GH16_19	0.0	1	494	1	494

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6IBU_A	4.18e-30	138	352	23	222	Apo Crh5 transglycosylase [Aspergillus fumigatus Af293],6IBU_B Apo Crh5 transglycosylase [Aspergillus fumigatus Af293],6IBW_A Crh5 transglycosylase in complex with NAG [Aspergillus fumigatus Af293],6IBW_B Crh5 transglycosylase in complex with NAG [Aspergillus fumigatus Af293]
5SV8_A	1.82e-12	163	348	30	203	Crystal Structure of the catalytic nucleophile and surface cysteine mutant of VvEG16 in complex with a xyloglucan oligosaccharide [Vitis vinifera]
5DZE_A	4.44e-12	163	348	29	202	Crystal Structure of the catalytic nucleophile mutant of VvEG16 in complex with cellotetraose [Vitis vinifera]
5DZF_A	4.51e-12	163	348	30	203	Crystal Structure of the catalytic nucleophile mutant of VvEG16 in complex with a mixed-linkage glucan octasaccharide [Vitis vinifera],5DZF_B Crystal Structure of the catalytic nucleophile mutant of VvEG16 in complex with a mixed-linkage glucan octasaccharide [Vitis vinifera]
5DZG_A	4.59e-12	163	348	31	204	Crystal Structure of the catalytic nucleophile mutant of VvEG16 in complex with a xyloglucan tetradecasaccharide [Vitis vinifera],5DZG_B Crystal Structure of the catalytic nucleophile mutant of VvEG16 in complex with a xyloglucan tetradecasaccharide [Vitis vinifera]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q05790|CRR1_YEAST	1.63e-130	17	407	15	406	Probable glycosidase CRR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CRR1 PE=2 SV=1
sp|Q75A41|CRR1_ASHGO	2.98e-107	10	419	5	422	Probable glycosidase CRR1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=CRR1 PE=3 SV=1
sp|Q5AJC0|UTR2_CANAL	1.80e-67	41	349	35	298	Extracellular glycosidase UTR2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=UTR2 PE=1 SV=1
sp|Q4WI46|CRF2_ASPFU	2.04e-65	31	352	24	299	Probable glycosidase crf2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=crf2 PE=1 SV=1
sp|P32623|CRH2_YEAST	4.33e-62	27	351	20	298	Probable glycosidase CRH2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UTR2 PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000235	0.999760	CS pos: 22-23. Pr: 0.9759

TMHMM  Annotations     

There is no transmembrane helices in CAGL0J08910g-T-p1.