CAZyme Information: CAGL0I04840g-T-p1

Basic Information

• Species: [Candida] glabrata
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; [Candida] glabrata
• CAZyme ID: CAGL0I04840g-T-p1
• CAZy Family: GT20
• CAZyme Description: Class IV chitin synthase with a calcineurin pathway- and Tor1p-dependent role in cell wall integrity, mutants have significantly thickened cell wall chitin-glucan layer, mutants delayed in cell wall formation during protoplast regeneration

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1064	ChrI_C_glabrata_CBS138|CGC2	121330.01	8.4908

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CglabrataCBS138	5615	284593	322	5293

• Gene Location: location=ChrI_C_glabrata_CBS138:434911-438105(+)

Full Sequence      

MVMTAIAGDKFLYPKLNKIVPFTLFSHHSPDLENPLLESELNTTENTKESISVINPGSKK
RHKARCRRNGRNELFQSKVRGWHFYCRVVTIFIPSKVLKFCGIRTVEQQRAWREKVGLIS
IILAIGAIVIYISFIFTNTACGYKQPKILHRNVSDSFIRINGRAYPFNWANIPESTPILI
SYYGLFAPKSYGGKDASLLFQNVNGNCHGIIKPRENCTIPHDNNGNLAWYFPCVVLSKDD
YMSWDPEIEIENKPSNCHISEFERDSYYYLEYPVNIYYTWDDIKNSNRSLVVYNNYVLDL
KILQMLYKYDLDVPPKLLELGSLPINGYDISVTLTTNYDKKLARCLIDIATVGLIDAEPL
GCIVANIILYLFLIFIMSIVILKFVIACYFRWVVAKAQGSFKVNNKTMIRIMRDIEDWAE
DINKKAPIMNVNFLPENTSLITRKRDIVEGISLHPKRMSNPTSILSGPNSSNVKSTTYLK
PNLKIGNSISQNFDSFIRKGENYCLCSFPETSNYRDSLLKSLNDGNLDPSIIHKNVVKPN
NIIHGSSDGFLNTICFVTCYSEGVRELRSTLDALCTTTYPNTHKLIILVCDGQVTGAHNK
KLTSEIALNMITDFIEDPNEVIPYSYLSIASGAKRFNMAKVYGGYYKYDSDTVEESQQQQ
VPIVLVSKCGSFYEIHSSPKPGNRGKRDSQIILMSLLQRAICNERMSELEFQLLKVIWQV
GGKMIMEYETVLMVDADTRVFPDSIRHMCAEMAKDTNIMGLCGETKIANKKESWVTAIQV
FEYYISHHHSKAFESIFGSVLCLPGCFSMFRIKSPKDKEQTCWVPILANPDIVECYSNNS
TDTLHQKNLLLLGEDRYLSSLLLRKFPNRKQVFVPKAACKTVVPSKFLVLLSQRRRWINS
TIHNLVDLLRHDNLCGTFCFSMQFVVLLELLGTILLPFAILSTIYVIIYSALFAPLPMLT
LVLLLVILGLPGVFIVITTTKLVYVVWMLVYLVALPIWNLILPVYAFWKFDDFSWGETRA
TKDGKRNDINETADTFNHTAVNMMTWKEHALDEKARGSRYPFAV

Enzyme Prediction     

EC	2.4.1.16:11

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	549	1049	1.6e-235	0.9506641366223909

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
367353	Chitin_synth_2	0.0	531	1048	4	523	Chitin synthase. Members of this family are fungal chitin synthase EC:2.4.1.16 enzymes. They catalyze chitin synthesis as follows: UDP-N-acetyl-D-glucosamine + {(1,4)-(N-acetyl-beta-D-glucosaminyl)}(N) <=> UDP + {(1,4)-(N-acetyl-beta-D-glucosaminyl)}(N+1).
133033	Chitin_synth_C	1.46e-82	555	904	1	244	C-terminal domain of Chitin Synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin. Chitin synthase, also called UDP-N-acetyl-D-glucosamine:chitin 4-beta-N-acetylglucosaminyltransferase, catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of GlcNAc residues formed by covalent beta-1,4 linkages. Chitin is an important component of the cell wall of fungi and bacteria and it is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases. Studies with fungi have revealed that most of them contain more than one chitin synthase gene. At least five subclasses of chitin synthases have been identified.
133045	CESA_like	5.03e-20	725	811	76	162	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
224136	BcsA	1.38e-15	715	1010	125	392	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
404513	Glyco_trans_2_3	3.97e-08	730	954	1	190	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QHS67105.1|GT2	0.0	1	1064	1	1064
CAG60397.1|GT2	0.0	1	1064	1	1064
QNG16153.1|GT2	0.0	1	1064	1	1064
UCS28021.1|GT2	0.0	1	1064	32	1095
UCS33250.1|GT2	0.0	1	1064	32	1095

PDB Hits     

CAGL0I04840g-T-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P29465|CHS3_YEAST	0.0	82	1048	169	1147	Chitin synthase 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CHS3 PE=1 SV=3
sp|P30573|CHS3_CANAX	7.08e-303	82	1059	167	1168	Chitin synthase 3 OS=Candida albicans OX=5476 GN=CHS3 PE=3 SV=1
sp|P78611|CHSD_EMENI	1.04e-270	82	1056	187	1171	Chitin synthase D OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=chsD PE=1 SV=4
sp|Q01285|CHS4_NEUCR	2.25e-268	82	1058	211	1195	Chitin synthase 4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=chs-4 PE=3 SV=3
sp|O13353|CHS4_MAGO7	1.98e-258	81	1060	206	1192	Chitin synthase 4 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) OX=242507 GN=CHS4 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000062	0.000004

TMHMM  Annotations     

Start	End
116	138
364	386
927	949
954	976
983	1005