CAZyme Information: CAGL0I04818g-T-p1

Basic Information

• Species: [Candida] glabrata
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; [Candida] glabrata
• CAZyme ID: CAGL0I04818g-T-p1
• CAZy Family: GT2
• CAZyme Description: Ortholog(s) have chitin synthase activity

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
914	ChrI_C_glabrata_CBS138|CGC4	105013.40	8.7138

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CglabrataCBS138	5615	284593	322	5293

• Gene Location: location=ChrI_C_glabrata_CBS138:431844-434588(+)

Full Sequence      

MTRNPFMVDSSPQRLTRFHTNNSTDELYDSQSFQGLPQSPSRAALRYSPERRNRQQFYRD
SNHNSPAVDRYTSNLQQSPHRPTETVIPMRPYENTYMSPTRFPSQSSKYTASTATALSFH
DEFKDKDDVSSYAYDDQSTIYTSNTFNETKFELNHPTRQPYVRRANSEMKKRNHEVPLAK
SKAILKLDNPIPKDLLDTLPRRDSPEFTEMRYTACTVEPDDFLAEGYGLRFAEMNRECQI
AICITMYNEDKFALARTIHSIMKNVAHLCSRERSSVWGPNGWKKVSVILISDGRAKVNQG
SLDYLAAIGLYQEDMAKASVNGDPVKAHIFELTTQVSINADLDYESQGIVPVQMVFCLKE
ENKKKINSHRWLFNAFCPVLQPNVVTLVDVGTRLNTTAVYHLWKVFDMDSNVAGAAGQIK
TMKGKWGLKLLNPLVASQNFEYKISNIMDKPLESVFGYITVLPGALSAYRYRALENHSDG
TGPLNSYFLGESQEGSSYDVFTANMYLAEDRILCWELIAKRDANWVLKYVKEATGETDVP
EDIPEFISQRRRWLNGAMFAALYAHLHFFQIWKTKHSFLRKFFLHIEFFYQFVQMTFSWF
SIANFVLTFYYLAGSMNRVIKHGEALFIFFKYLIFCDLASLFIISMGNRPQGAKVLFILS
MILLTICAAYSLICGFVFAIIALKSQSEPHHIFVNVVISLLSTYGAYAFCSFMYLDPWHV
FSSSIQYFLTLPAFTCTLQIFAFCNTHDVSWGTKGSTQESKQLSKAIVVQGPDGTQIVET
DWPQEVDKKFLEIKSRLKEVEYEDVHVDESQKRNDYYRDIRTRIVMIWMLSNLILIMSII
QAYPPERINNGYLIFILWSVAALAGFRAVGSISFLFMKYLRMGVKYMHKRQRGTAKGVHM
KAPKINIFNKEGST

Enzyme Prediction     

EC	2.4.1.16:26	2.4.1.16:26

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	246	406	2.2e-70	0.9938650306748467

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396286	Chitin_synth_1	2.02e-98	246	406	1	163	Chitin synthase. This region is found commonly in chitin synthases classes I, II and III. Chitin a linear homopolymer of GlcNAc residues, it is an important component of the cell wall of fungi and is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases.
133033	Chitin_synth_C	1.80e-96	242	560	1	244	C-terminal domain of Chitin Synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin. Chitin synthase, also called UDP-N-acetyl-D-glucosamine:chitin 4-beta-N-acetylglucosaminyltransferase, catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of GlcNAc residues formed by covalent beta-1,4 linkages. Chitin is an important component of the cell wall of fungi and bacteria and it is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases. Studies with fungi have revealed that most of them contain more than one chitin synthase gene. At least five subclasses of chitin synthases have been identified.
224136	BcsA	2.64e-33	355	763	115	431	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
400626	Chitin_synth_1N	1.65e-27	185	245	9	70	Chitin synthase N-terminal. This is the N-terminal domain of Chitin synthase (pfam01644).
133045	CESA_like	1.18e-17	244	491	3	179	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QHS67104.1|GT2	0.0	1	914	1	914
CAG60396.1|GT2	0.0	1	914	1	914
QNG16152.1|GT2	0.0	1	914	1	914
UCS28020.1|GT2	0.0	1	914	1	914
UCS22788.1|GT2	0.0	1	914	1	914

PDB Hits     

CAGL0I04818g-T-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P14180|CHS2_YEAST	0.0	1	912	1	963	Chitin synthase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CHS2 PE=1 SV=1
sp|P23316|CHS1_CANAX	6.55e-275	185	889	31	761	Chitin synthase 1 OS=Candida albicans OX=5476 GN=CHS1 PE=2 SV=2
sp|P30584|CHSA_EMENI	2.33e-255	166	910	220	978	Chitin synthase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=chsA PE=3 SV=2
sp|P30589|CHS2_NEUCR	1.13e-254	135	874	281	1045	Chitin synthase 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=chs-2 PE=3 SV=4
sp|Q92444|CHS2_PARBR	4.90e-245	185	877	252	962	Chitin synthase 2 OS=Paracoccidioides brasiliensis OX=121759 GN=CHS2 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000036	0.000000

TMHMM  Annotations     

Start	End
592	614
626	648
658	680
693	715
725	744
822	844
854	876