CAZyme Information: CAGL0G00220g-T-p1

Basic Information

• Species: [Candida] glabrata
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; [Candida] glabrata
• CAZyme ID: CAGL0G00220g-T-p1
• CAZy Family: GH5
• CAZyme Description: Ortholog(s) have 1,3-beta-glucanosyltransferase activity, glucan endo-1,3-beta-D-glucosidase activity, role in fungal-type cell wall organization and fungal-type cell wall localization

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
308	ChrG_C_glabrata_CBS138|CGC4	33688.25	4.1863

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CglabrataCBS138	5615	284593	322	5293

• Gene Location: location=ChrG_C_glabrata_CBS138:18798-19724(+)

Full Sequence      

MRFSTVAALAFGASQVAAIGELAFNLGVKNNDGTCKTTNDYENDLKVLKSYTSTVKVYAA
SDCNTLENLGPAAEAEGFNIFLGIWPNDEAHFQAEKNALSSFLPNLKSSTIAGFLVGSEA
LYRDDLTASQLADKINDIRNYVSNIKDSQGNSYSGKQVGTVDSWNVLVAGYNAPVITASD
FVMANAFSYWQGQTMQNASYSFFDDIMQALQTIQGVKGSTDITFWVGETGWPTDGTNFEA
SYPSVDNAKQFWKEGICAMRAWGVNVIVFEAFDEDWKPNTSGTSDVEKHWGVWTSGDNLK
YSLDCSFN

Enzyme Prediction     

EC	3.2.1.39:6	3.2.1.-:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	23	305	7.6e-48	0.9935691318327974

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
366033	Glyco_hydro_17	5.97e-113	22	305	1	309	Glycosyl hydrolases family 17.
227625	Scw11	1.10e-111	3	297	20	305	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QHS66006.1|GH17	2.71e-230	1	308	1	308
CAG59301.1|GH17	2.71e-230	1	308	1	308
CAY05229.1|GH17	2.71e-230	1	308	1	308
QNG13711.1|GH17	2.71e-230	1	308	1	308
UCS25575.1|GH17	2.71e-230	1	308	1	308

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	2.46e-42	12	300	26	289	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]
4WTR_A	1.89e-41	12	300	26	289	Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaribiose [Rhizomucor miehei CAU432],4WTS_A Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaritriose [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P15703|BGL2_YEAST	4.44e-194	1	308	1	313	Glucan 1,3-beta-glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BGL2 PE=1 SV=1
sp|Q5AMT2|BGL2_CANAL	2.14e-149	1	308	1	308	Glucan 1,3-beta-glucosidase BGL2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=BGL2 PE=1 SV=2
sp|P43070|BGL2_CANAX	5.00e-148	1	308	1	308	Glucan 1,3-beta-glucosidase OS=Candida albicans OX=5476 GN=BGL2 PE=3 SV=1
sp|O13990|BGL2_SCHPO	3.67e-87	20	306	40	319	Glucan 1,3-beta-glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=bgl2 PE=2 SV=4
sp|D4B2W4|BGL2_ARTBC	9.15e-74	1	308	1	304	Glucan 1,3-beta-glucosidase ARB_02797 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_02797 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000429	0.999539	CS pos: 18-19. Pr: 0.9756

TMHMM  Annotations     

There is no transmembrane helices in CAGL0G00220g-T-p1.