CAZyme Information: CAGL0D06270g-T-p1

Basic Information

• Species: [Candida] glabrata
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; [Candida] glabrata
• CAZyme ID: CAGL0D06270g-T-p1
• CAZy Family: GT91
• CAZyme Description: Ortholog(s) have N-acetylglucosaminyldiphosphodolichol N-acetylglucosaminyltransferase activity and role in dolichol-linked oligosaccharide biosynthetic process

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
198		22088.50	6.0002

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CglabrataCBS138	5615	284593	322	5293

• Gene Location: location=ChrD_C_glabrata_CBS138:592585-593181(-)

Full Sequence      

MSAFVTCGATVPFPALVEAVLAPEFVGCLSREGYRVLCVQFGRGYDFEAQFTSVTCTRMP
LESAEVSELRQLVRDERVTVMGYKVQDVVVLGFAYSNNILQIIDRYGDVVISHAGTGSIL
DSLRLNKKLIVVVNHTLMDNHQKQIAEKFQNLGHILATNPTAIELCDAMKRLKHEDLIPL
SSETNTEFMERLKSIAYS

Enzyme Prediction     

No EC number prediction in CAGL0D06270g-T-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227350	COG5017	1.29e-26	3	198	2	161	UDP-N-acetylglucosamine transferase subunit ALG13 [Carbohydrate transport and metabolism].
397977	Glyco_tran_28_C	2.98e-14	4	149	3	118	Glycosyltransferase family 28 C-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). Structural analysis suggests the C-terminal domain contains the UDP-GlcNAc binding site.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAG58589.1|GT1	2.18e-138	1	198	1	198
QHS65316.1|GT1	2.18e-138	1	198	1	198
UCS24892.1|GT1	2.18e-138	1	198	1	198
UCS30122.1|GT1	2.18e-138	1	198	1	198
UCS19659.1|GT1	2.18e-138	1	198	1	198

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2KS6_A	4.45e-39	4	198	9	201	NMR solution structure of ALG13 --- obtained with iterative CS-Rosetta from backbone NMR data. [Saccharomyces cerevisiae]
2JZC_A	8.35e-39	4	198	32	224	NMR solution structure of ALG13: The sugar donor subunit of a yeast N-acetylglucosamine transferase. Northeast Structural Genomics Consortium target YG1 [Saccharomyces cerevisiae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q6FVR6|ALG13_CANGA	3.88e-139	1	198	1	198	UDP-N-acetylglucosamine transferase subunit ALG13 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) OX=284593 GN=ALG13 PE=3 SV=1
sp|P53178|ALG13_YEAST	2.35e-38	4	198	10	202	UDP-N-acetylglucosamine transferase subunit ALG13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ALG13 PE=1 SV=1
sp|Q750J3|ALG13_ASHGO	2.43e-35	5	197	17	202	UDP-N-acetylglucosamine transferase subunit ALG13 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=ALG13 PE=3 SV=1
sp|Q6CXY0|ALG13_KLULA	3.26e-34	5	196	7	195	UDP-N-acetylglucosamine transferase subunit ALG13 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 GN=ALG13 PE=3 SV=1
sp|Q5ABE5|ALG13_CANAL	1.51e-24	2	156	76	236	UDP-N-acetylglucosamine transferase subunit ALG13 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ALG13 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000076	0.000000

TMHMM  Annotations     

There is no transmembrane helices in CAGL0D06270g-T-p1.