CAZyme Information: CAGL0B02321g-T-p1

Basic Information

• Species: [Candida] glabrata
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; [Candida] glabrata
• CAZyme ID: CAGL0B02321g-T-p1
• CAZy Family: AA6
• CAZyme Description: Ortholog(s) have alpha-1,6-mannosyltransferase activity, role in cell wall mannoprotein biosynthetic process, protein N-linked glycosylation and mannan polymerase complex localization

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
512	ChrB_C_glabrata_CBS138|CGC2	58621.70	4.9804

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CglabrataCBS138	5615	284593	322	5293

• Gene Location: location=ChrB_C_glabrata_CBS138:220222-221760(+)

Full Sequence      

MMMSIPSFRDLAKLRRSADNKRGGEYSLPISRTGSEATLSKHDKFIAKKKNFKFRKLATG
AIIVIVIVSIFLVFFNIEVSPISLPSSFYHKEYLPFEFKDAAYHSFDFEDIDMDIVSKFD
QGIMNYLISEYGTENPSESDLAEYNDNLQMLLDSTVEKYDLGNFQGSADGFEQQEHILVC
VPLRDAEEVLPLMFKNLMNLTYPHELIDLAFLVSDCSEGDKTLEALETYSQLLQEGILPD
ILADMDNYNKGKSNESIHLKYMEPDYLKRVKAAYKPPFHPNYSKPFRSVQIFQKDFGQVI
GQGFSDRHAVKVQGIRRKLMGRARNWLMSNALKPYHSWVYWRDADVELCPGSVIEDLMLQ
DYDVIVPNVWRPLPKFLNSAQPYDLNSWMESNEALQLAKTLDEDDVIVEGYAEYPTYRVH
LAYIREEDGDPTQVVDLDGVGGVSILARARVFREGVHFSAFTFENHAETEAFGKMAKKVG
FRVGGLPHYTLWHIYEPSDDDLLAMAKLEKGK

Enzyme Prediction     

No EC number prediction in CAGL0B02321g-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT62	154	462	3.3e-127	0.9888059701492538

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397491	Anp1	2.50e-157	155	462	1	265	Anp1. The members of this family (Anp1, Van1 and Mnn9) are membrane proteins required for proper Golgi function. These proteins co-localize within the cis Golgi, and that they are physically associated in two distinct complexes.
133049	CESA_like_2	0.002	176	229	2	53	CESA_like_2 is a member of the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, Glucan Biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of glucan.
133045	CESA_like	0.003	181	274	3	103	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QHS64690.1|GT62	0.0	1	512	1	512
CAG57971.1|GT62	0.0	1	512	1	512
UCS19024.1|GT62	0.0	1	512	1	512
UCS24257.1|GT62	0.0	1	512	1	512
UCS29487.1|GT62	0.0	1	512	1	512

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3ZF8_A	3.70e-51	156	498	6	304	Crystal structure of Saccharomyces cerevisiae Mnn9 in complex with GDP and Mn. [Saccharomyces cerevisiae S288C]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P23642|VAN1_YEAST	4.30e-226	27	512	21	530	Mannan polymerase I complex VAN1 subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=VAN1 PE=1 SV=3
sp|Q00314|VAN1_CANAX	1.76e-180	134	512	56	437	Vanadate resistance protein OS=Candida albicans OX=5476 GN=VAN1 PE=3 SV=1
sp|P32629|ANP1_YEAST	4.73e-127	155	506	61	367	Mannan polymerase II complex ANP1 subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ANP1 PE=1 SV=3
sp|O74745|ANP1_SCHPO	5.29e-122	154	512	75	390	Mannan polymerase II complex anp1 subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=anp1 PE=3 SV=1
sp|P53697|MNN9_CANAL	5.36e-57	148	496	65	368	Mannan polymerase complex subunit MNN9 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN9 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999847	0.000175

TMHMM  Annotations     

Start	End
57	79