CAZyme Information: CAG99810.1

Basic Information

• Species: Kluyveromyces lactis
• Lineage: Ascomycota; Saccharomycetes; ; Saccharomycetaceae; Kluyveromyces; Kluyveromyces lactis
• CAZyme ID: CAG99810.1
• CAZy Family: GH63
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
417		49000.59	9.2632

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KlactisNRRLY-1140	5389	284590	313	5076

• Gene Location: location=CR382125:1526177-1527430(+)

Full Sequence      

MFIDSEYSSFLIINVTFFAVKLLQFGLVWLAPRTFDTSTHLFLEHYGITSNPWWGKLLSW
DSIFFLKTSLWMRNSGYSAPQYEHEWAFSPIWSIIIQSSDLQHIVLKAVSFNLLLHYLST
WIVYALTKLTFPPFGQNVQTKLALTTSVLFILSSAAGFLISVYSEPIAFTFSLLGMLFRQ
WSISFDVYGNLHMDKLKWISYLLSSFCFAFAFLNRSNCLLLGLFYVHDCLNLFKQKKWIT
SIFYPILSGTILFGVFVYFHYYFPYAALCPERGEWCNSKIYGLPIPYQSLYSYIQSKHWN
VGFLKYWTPNNIPNFLFGLPNIVITWNAITYFSYQYPSRNMKPYIWIARIFLFIMVFLAN
VQIINRVSSFLPLSLWYISDSLIKNPHEMRIVKYYVMWLLIWIPTQTALFACFLPPA

Enzyme Prediction     

No EC number prediction in CAG99810.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT76	17	417	3e-94	0.9877149877149877

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
282094	Mannosyl_trans2	7.48e-51	12	417	1	439	Mannosyltransferase (PIG-V). This is a family of eukaryotic ER membrane proteins that are involved in the synthesis of glycosylphosphatidylinositol (GPI), a glycolipid that anchors many proteins to the eukaryotic cell surface. Proteins in this family are involved in transferring the second mannose in the biosynthetic pathway of GPI.
227829	COG5542	1.86e-28	1	417	22	408	Mannosyltransferase related to Gpi18 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
XP_454723.1|GT76	7.42e-315	1	417	1	417
CAG99810.1|GT76	7.42e-315	1	417	1	417
QEU61497.1|GT76	5.76e-303	1	417	1	417
QGN17451.1|GT76	5.34e-230	1	417	1	417
BAO41404.1|GT76	1.08e-229	1	417	1	417

PDB Hits     

CAG99810.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q6CMW6|GPI18_KLULA	1.32e-315	1	417	1	417	GPI mannosyltransferase 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 GN=GPI18 PE=3 SV=1
sp|Q757K7|GPI18_ASHGO	2.23e-140	13	417	7	427	GPI mannosyltransferase 2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=GPI18 PE=3 SV=1
sp|P38211|GPI18_YEAST	1.44e-116	11	417	1	433	GPI mannosyltransferase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GPI18 PE=1 SV=2
sp|Q6FWN4|GPI18_CANGA	7.00e-109	17	417	11	433	GPI mannosyltransferase 2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) OX=284593 GN=GPI18 PE=3 SV=1
sp|Q6BRZ9|GPI18_DEBHA	1.88e-55	17	417	11	428	GPI mannosyltransferase 2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / BCRC 21394 / JCM 1990 / NBRC 0083 / IGC 2968) OX=284592 GN=GPI18 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000047	0.000000

TMHMM  Annotations     

Start	End
10	32
105	127
142	164
166	183
198	220
241	263
311	333
345	364
394	416