CAZyme Information: CAG99696.1

Basic Information

• Species: Kluyveromyces lactis
• Lineage: Ascomycota; Saccharomycetes; ; Saccharomycetaceae; Kluyveromyces; Kluyveromyces lactis
• CAZyme ID: CAG99696.1
• CAZy Family: GH47
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
845	CR382125|CGC14	93002.96	4.7384

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KlactisNRRLY-1140	5389	284590	313	5076

• Gene Location: location=CR382125:1304707-1307244(-)

Full Sequence      

MSNFDIEQTLSELTRDEKISLLSAVDFWHTKEIERLGIPSVRVSDGPNGIRGTRFFDSVP
SGCFPNGTGLASTFDDELLKEAGKLMAKEAVAKNAAVILGPTTNMQRGPLGGRGFESFSE
DPYLAGVATSSVVQGMQSEGIAATVKHFVCNDLEDQRFASNSILSERALREIYLEPFRLA
IKNADPVCLMTAYNKVNGEHCSQNKKLLLDILRKEWNWDGMIMSDWYGTYTTAASIKNGL
DIEFPGPTRWRTNELVSHSLNSKEQISIYDVDDRVRQVLKMIKFVVDNQEKTGIVQNGPE
TTSNNTKETSELLRKIAADSIVLLKNENSILPLKKEESIVVIGPNAKAKASSGGGSASVN
SYYVISPYEGIVKKVGKEVPYTIGAESHKTLSNLIEQLVVDPSKPAEGDNAGATGSFYSE
PVEKRAKDESPFHVATFKHSFNLLFDFKHEKIDTTNPIFYITLEGYFTPEEDADYIFGLQ
VFGTGVLYLDDELLIDQRKGQVSGDFCFGAGTIEKTKTVTLQKGKAYKVRIEYGSGPTSE
LVSEFGSGALQVGVTKAIDADEEIKKAAKLAAAHDKAILCIGLNAEWESEGHDREDMTLP
ARTNDLVRAVLEANPNTVIVNQSGTPVEFPWLQKANALVQAWYGGNELGNAIADVLYGDV
VPNGKLSLSWPLKLEDNPAYLNFKTEFGRVVYGEDIFIGYRFYEKLQKRVAFPFGYGLSY
TEFALSNLQVQINDEVISVSVDVKNTGEKYAGSEVVQVYIAATESSVSRAVKELKGFKKV
LLQPGQTETAKIDLVLKDSVSFFDEEVGKWCSEAGQYKVLVGTSSDDIVLSESFDVEKTS
YWSGL

Enzyme Prediction     

EC	3.2.1.21:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	31	244	1.6e-62	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	6.93e-76	35	835	101	763	beta-glucosidase BglX.
224389	BglX	7.38e-69	26	381	48	393	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	3.33e-50	321	700	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
395747	Glyco_hydro_3	4.94e-39	31	279	59	314	Glycosyl hydrolase family 3 N terminal domain.
178629	PLN03080	2.03e-35	10	780	57	728	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAG99696.1|GH3	0.0	1	845	1	845
QEU61608.1|GH3	0.0	1	845	1	845
QEU61154.1|GH3	0.0	1	845	1	845
ACF93471.1|GH3|3.2.1.21	0.0	1	845	3	847
QEU60335.1|GH3	0.0	1	845	3	847

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3ABZ_A	0.0	2	845	2	845	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
3AC0_A	0.0	1	845	1	845	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
7MS2_A	4.74e-147	5	839	4	671	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	3.45e-111	9	828	8	655	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	5.03e-99	6	836	4	713	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P07337|BGLS_KLUMA	0.0	1	845	1	845	Beta-glucosidase OS=Kluyveromyces marxianus OX=4911 PE=3 SV=1
sp|A1CA51|BGLI_ASPCL	1.65e-291	1	845	1	838	Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglI PE=3 SV=1
sp|Q4WU49|BGLI_ASPFU	7.03e-288	1	845	1	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglI PE=3 SV=1
sp|B0Y3M6|BGLI_ASPFC	7.03e-288	1	845	1	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglI PE=3 SV=1
sp|A1DFA8|BGLI_NEOFI	2.29e-286	1	845	1	838	Probable beta-glucosidase I OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000020	0.000017

TMHMM  Annotations     

There is no transmembrane helices in CAG99696.1.