CAZyme Information: CAG99334.1

Basic Information

• Species: Kluyveromyces lactis
• Lineage: Ascomycota; Saccharomycetes; ; Saccharomycetaceae; Kluyveromyces; Kluyveromyces lactis
• CAZyme ID: CAG99334.1
• CAZy Family: GH18
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1147	CR382125|CGC15	129710.53	4.5593

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_KlactisNRRLY-1140	5389	284590	313	5076

• Gene Location: location=CR382125:598212-601655(-)

Full Sequence      

MLIVPFILFSVAILAPIYFYLTKPLPLQHTHFGSFVCAEDTLFCPESQRKASEKMYSLLK
DHENTFYDEEQQILGNLLLSENTFSRQPYVANGYIGSRIPNLGFGYALDTINVWVNDSSI
PGALDNGWPLRNQRFAGAFISDFYCLQEKLNSTNFPELDDDGYSTVISTIPQWTDLSILK
HTTTGQIEYINPTDVKLDKITNYMQNLSLQDGIVTTTFVYDKQLLVTTKVVAHRKIYPLG
VVTLELSLFDNNSDTSADNENEYVELEICDSLNFSTSHRTVLNDYGYDQNNEGIFMVVEP
ENVPYSNASLFSYFDIPSRDTLTLSKYSDSISQCTTQILKANSTFVAHKYIGIISSEYDN
KQPDDNSNGTSNEALKMSNLERATSIVLDNKGNYDSLIQSHKNAWKRIYKDASIEIPSDG
LLEMTAKSSIYHLLANTRSHNVSEDRGLPIGVSGLSSDSYGGMVFWDSDLWILPALLPFF
PNAARQINNYRNASLHQAKLNAEKYGYDGALYPWTSGRYANCTSTGPCVDYEYHINVDIA
LSSFAIYMNGDEDDERSEEYLRYTTWPFVENAAKMFAQYVKWNDTMQQYTTHNLTDPDEY
ANFVDNAAFTNAGIQSVMVWAHDIARHLGIDPDPQWLEIADNIHIPISETNITLEYSGMN
SSVEIKQADVVLMIYPLSYITDQSILNNAIKNLYYYSERQSASGPAMTYPVFVAGAASLL
NYGSSSQSYLYKSVVPYLRSPFAQFSEQSDDNFLTNGLTQPAFPFLTANGGFLQSILFGL
TGLRYSYEVDEDTGKIHRLLKFNPIQLPLLPGGIRINNFKYMGQVLDVLITDTEGIIIHK
NGTKEIRIKVPDRTLIPDVDVKYSEETDPIKQILHGRRSVPTGKNYFTIQPGDVFKTPLY
IPKKNLEGNLVEAKQITNLTAGVPGDVAVSVIDGNNFTHWQPAYKNLPARLLIDMGNNFT
QEIKSGKIIWGSRPAKTFSLSILPQTEEVFKNLTHILSNVNQYCNKTGDECVRDLERTEK
GFDAAIEDVFDWYGIDPDSIISTHPELKDMKTKFVKILDHYKVTPSEPYPWRVYNESQIV
LLPGNETDFDIDYSKVAEMNPENVDIDFRGNQTDWRKGRFIVLTVHDTYDDDDDEKGATI
KEFALFP

Enzyme Prediction     

EC	3.2.1.28:7

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH65	428	786	9.3e-92	0.989247311827957

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224471	ATH1	1.10e-126	74	942	20	772	Trehalose and maltose hydrolase (possible phosphorylase) [Carbohydrate transport and metabolism].
281612	Glyco_hydro_65m	2.99e-35	430	784	4	381	Glycosyl hydrolase family 65 central catalytic domain. This family of glycosyl hydrolases contains vacuolar acid trehalase and maltose phosphorylase.Maltose phosphorylase (MP) is a dimeric enzyme that catalyzes the conversion of maltose and inorganic phosphate into beta-D-glucose-1-phosphate and glucose. The central domain is the catalytic domain, which binds a phosphate ion that is proximal the the highly conserved Glu. The arrangement of the phosphate and the glutamate is thought to cause nucleophilic attack on the anomeric carbon atom. The catalytic domain also forms the majority of the dimerization interface.
237517	PRK13807	9.06e-22	79	675	24	599	maltose phosphorylase; Provisional
397616	Glyco_hydro_65N	3.74e-15	76	356	9	240	Glycosyl hydrolase family 65, N-terminal domain. This family of glycosyl hydrolases contains vacuolar acid trehalase and maltose phosphorylase.Maltose phosphorylase (MP) is a dimeric enzyme that catalyzes the conversion of maltose and inorganic phosphate into beta-D-glucose-1-phosphate and glucose. This domain is believed to be essential for catalytic activity although its precise function remains unknown.
397613	Glyco_hydro_65C	0.009	808	856	1	50	Glycosyl hydrolase family 65, C-terminal domain. This family of glycosyl hydrolases contains vacuolar acid trehalase and maltose phosphorylase.Maltose phosphorylase (MP) is a dimeric enzyme that catalyzes the conversion of maltose and inorganic phosphate into beta-D-glucose-1-phosphate and glucose. The C-terminal domain forms a two layered jelly roll motif. This domain is situated at the base of the catalytic domain, however its function remains unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAG99334.1|GH65	0.0	1	1147	1	1147
QEU62830.1|GH65	0.0	1	1146	1	1146
BAP73405.1|GH65	0.0	1	1146	1	1155
QGN18122.1|GH65	0.0	1	1146	1	1155
BAO41987.1|GH65	0.0	1	1146	1	1157

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7FE3_A	2.74e-45	191	783	91	640	Chain A, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE3_B Chain B, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE3_C Chain C, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE4_A Chain A, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE4_B Chain B, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE4_C Chain C, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101]
3WIQ_A	3.56e-23	395	850	276	749	Crystal structure of kojibiose phosphorylase complexed with kojibiose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_A Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_B Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_C Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_D Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903]
1H54_A	1.26e-21	90	658	31	557	Chain A, Maltose Phosphorylase [Levilactobacillus brevis],1H54_B Chain B, Maltose Phosphorylase [Levilactobacillus brevis]
4KTP_A	8.86e-21	313	611	178	487	Chain A, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTP_B Chain B, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10]
4KTR_A	1.17e-20	313	611	178	487	Chain A, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_B Chain B, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_C Chain C, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_D Chain D, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_E Chain E, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_F Chain F, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_G Chain G, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_H Chain H, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|M1RNJ8|ATH1_CANGB	0.0	26	1145	129	1210	Periplasmic/secreted acid trehalase ATH1 OS=Candida glabrata OX=5478 GN=ATH1 PE=1 SV=1
sp|P48016|ATH1_YEAST	0.0	45	1145	105	1209	Periplasmic acid trehalase ATH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ATH1 PE=1 SV=1
sp|N1P212|ATH1_YEASC	0.0	45	1145	105	1209	Periplasmic acid trehalase ATC1 OS=Saccharomyces cerevisiae (strain CEN.PK113-7D) OX=889517 GN=CENPK1137D_1727 PE=1 SV=1
sp|Q5AAU5|ATC1_CANAL	2.68e-212	52	981	88	965	Cell wall acid trehalase ATC1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ATC1 PE=1 SV=2
sp|D4B5H9|ATC1_ARTBC	1.84e-110	79	974	74	938	Cell wall acid trehalase ARB_03719 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_03719 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.995707	0.004338

TMHMM  Annotations     

Start	End
2	21