CAZyme Information: CAG90838.2

Basic Information

• Species: Debaryomyces hansenii
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Debaryomyces; Debaryomyces hansenii
• CAZyme ID: CAG90838.2
• CAZy Family: GT39
• CAZyme Description: GPI mannosyltransferase 1 [Source:UniProtKB/Swiss-Prot;Acc:Q6BHI9]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
414	CR382139|CGC1	47872.65	9.2676

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_DhanseniiCBS767	6698	284592	426	6272

• Gene Location: location=CR382139:1480739-1481983(-)

Full Sequence      

MLQLSISHIIVLSLLIRIGFFLFGLYQDKYMTVKYTDIDYVVFSDAANYVYNGYSPYSRE
TYRYTPLLAWMLIPNCWGGQWSNFGKYIFMISDLITGIIILKLLSGISIAGKKLSTNKII
MLSSIWLLNPMVITISTRGSSESVLTVMIMLSLYYLINKKSIIASGFWLGLSIHFKIYPV
IYLPSIMLYLSTSGTPFIDVPIVRWVNRTNIKFLITTLITIGAFNGIMYSIYGYEFLYNS
YLYHLIRIDHRHNFSVYNVALYYKSALSEIAEASLGFFTGNMEKFVMLPQLSISALILPL
LFARRDLISCIFIQTFAFVTFNKVITSQYFIWFLIFLPHYLAQSKLYSNKHMMKGIVALL
LWIVSQGSWLYFAYQLEFLGISTFDNGLLFSSFFFYISNCWILSVFIDDLNNDL

Enzyme Prediction     

EC	2.4.1.-:14

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT50	135	407	3.5e-87	0.9961832061068703

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
178434	PLN02841	3.57e-76	9	407	11	415	GPI mannosyltransferase
252941	Mannosyl_trans	2.91e-64	135	407	1	259	Mannosyltransferase (PIG-M). PIG-M has a DXD motif. The DXD motif is found in many glycosyltransferases that utilize nucleotide sugars. It is thought that the motif is involved in the binding of a manganese ion that is required for association of the enzymes with nucleotide sugar substrates.
399599	PIG-U	1.53e-06	52	245	46	242	GPI transamidase subunit PIG-U. Many eukaryotic proteins are anchored to the cell surface via glycosylphosphatidylinositol (GPI), which is posttranslationally attached to the carboxyl-terminus by GPI transamidase. The mammalian GPI transamidase is a complex of at least four subunits, GPI8, GAA1, PIG-S, and PIG-T. PIG-U is thought to represent a fifth subunit in this complex and may be involved in the recognition of either the GPI attachment signal or the lipid portion of GPI.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAG90838.2|GT50	1.44e-290	1	414	1	414
QFZ46763.1|GT50	1.76e-170	5	407	3	412
QFZ35388.1|GT50	1.76e-170	5	407	3	412
QFZ29738.1|GT50	1.76e-170	5	407	3	412
QFZ41082.1|GT50	1.76e-170	5	407	3	412

PDB Hits     

CAG90838.2 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q6BHI9|GPI14_DEBHA	2.55e-291	1	414	1	414	GPI mannosyltransferase 1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / BCRC 21394 / JCM 1990 / NBRC 0083 / IGC 2968) OX=284592 GN=GPI14 PE=3 SV=2
sp|Q5AMR5|GPI14_CANAL	7.59e-168	5	410	3	398	GPI mannosyltransferase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=GPI14 PE=3 SV=1
sp|P47088|GPI14_YEAST	2.53e-106	11	410	10	389	GPI mannosyltransferase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GPI14 PE=1 SV=2
sp|Q4I073|GPI14_GIBZE	5.89e-104	12	409	16	407	GPI mannosyltransferase 1 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GPI14 PE=3 SV=1
sp|Q6FXQ5|GPI14_CANGA	4.46e-100	1	413	1	401	GPI mannosyltransferase 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) OX=284593 GN=GPI14 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999820	0.000200

TMHMM  Annotations     

Start	End
4	26
87	109
119	136
149	171
181	203
210	232
285	302
315	337
352	374
387	407