CAZyme Information: CAG90546.2

Basic Information

• Species: Debaryomyces hansenii
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Debaryomyces; Debaryomyces hansenii
• CAZyme ID: CAG90546.2
• CAZy Family: GT34
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
654	CR382139|CGC9	74363.93	9.7333

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_DhanseniiCBS767	6698	284592	426	6272

• Gene Location: location=CR382139:1003647-1005611(+)

Full Sequence      

MDGNFRRMSGEKEPHRPQPTALGRFELIIKFVFRCAILPWLLWELGFRSYYKTVLGVFDM
IFKVLSLLIAPENGGLFNGISGDNGRYGVNSAGGVDIDGLFDDVLREGKVNVEKKSDTFI
SRINSRYRWVIDGIESQQIWQSTRENVEELYFIFEKADYVFDRYVKHSPFCVLNKLNPNG
KKSHYEYDGIPLSKFEGFGSYLSYKRLGTKTLTTTKPHLHPILSSTMTAIQKPVVAKREA
PKAEVNPTVSRSTQTETIKPTKERTVSVFSPPVFNFAANSFAQSVSNEYKHASPKRIKLD
NSRVQVPSIVKPKQDKPRPPAIVTKPRVINIEFPNKQKSGFKLLIRPKHEPSIKKQKQGI
EVLSTSNTKRITKSISVDDVEYVEKVKHAIKQVLPKPDYDDGSLGPVILRLAWHCCATYN
KFTGNGGSNGSTMRFVPEITDDGNSGLDIARSALEPIKQKFPDITYSDLWTLAGKISIQE
MGGPKIPWRCGRVDCIDDRYVPPNGRLPFAYKNANHIRETFGRMGFNDRETVSLLGAHGL
GRCHKRFSGWEGKWTENPTSFSNDFYKVLLDEEWSLGTVPETGKEQYYNKDKSLIMLNTD
IELIRDPHFLHFVKLYSQHQATFFQDFANAFGKLLELGIERDSNGNVLPKNEFY

Enzyme Prediction     

No EC number prediction in CAG90546.2.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA2	397	638	4.8e-57	0.9372549019607843

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
173825	ascorbate_peroxidase	2.63e-139	378	642	8	253	Ascorbate peroxidases and cytochrome C peroxidases. Ascorbate peroxidases are a subgroup of heme-dependent peroxidases of the plant superfamily that share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Along with related catalase-peroxidases, ascorbate peroxidases belong to class I of the plant superfamily. Ascorbate peroxidases are found in the chloroplasts and/or cytosol of algae and plants, where they have been shown to control the concentration of lethal hydrogen peroxide molecules. The yeast cytochrome c peroxidase is a divergent member of the family; it forms a complex with cytochrome c to catalyze the reduction of hydrogen peroxide to water.
223453	KatG	3.42e-63	378	639	56	417	Catalase (peroxidase I) [Inorganic ion transport and metabolism].
178218	PLN02608	1.96e-60	406	645	32	250	L-ascorbate peroxidase
178467	PLN02879	7.48e-59	405	638	34	246	L-ascorbate peroxidase
173823	plant_peroxidase_like	5.49e-57	388	636	1	255	Heme-dependent peroxidases similar to plant peroxidases. Along with animal peroxidases, these enzymes belong to a group of peroxidases containing a heme prosthetic group (ferriprotoporphyrin IX), which catalyzes a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. The plant peroxidase-like superfamily is found in all three kingdoms of life and carries out a variety of biosynthetic and degradative functions. Several sub-families can be identified. Class I includes intracellular peroxidases present in fungi, plants, archaea and bacteria, called catalase-peroxidases, that can exhibit both catalase and broad-spectrum peroxidase activities depending on the steady-state concentration of hydrogen peroxide. Catalase-peroxidases are typically comprised of two homologous domains that probably arose via a single gene duplication event. Class II includes ligninase and other extracellular fungal peroxidases, while class III is comprised of classic extracellular plant peroxidases, like horseradish peroxidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNP98603.1|AA2	2.60e-99	386	647	9	269
QGI94677.1|AA2	4.47e-95	384	647	20	287
QGI63795.1|AA2	4.47e-95	384	647	20	287
QKD61761.1|AA2	4.47e-95	383	647	19	287
QGI81067.1|AA2	4.47e-95	384	647	20	287

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5AMM_A	2.89e-72	404	638	25	258	Structure of Leishmania major peroxidase D211N mutant [Leishmania major],5AMM_B Structure of Leishmania major peroxidase D211N mutant [Leishmania major]
1JCI_A	1.20e-71	381	639	17	274	Chain A, Cytochrome C Peroxidase [Saccharomyces cerevisiae]
4GED_A	1.46e-71	404	638	25	258	Crystal Structure of the Leishmania Major Peroxidase-Cytochrome C Complex [Leishmania major]
3RIV_A	1.61e-71	404	638	26	259	The Crystal Structure of Leishmania major Peroxidase [Leishmania major strain Friedlin],3RIV_B The Crystal Structure of Leishmania major Peroxidase [Leishmania major strain Friedlin]
5AL9_A	2.19e-71	404	638	25	258	Structure of Leishmania major peroxidase D211R mutant (high res) [Leishmania major],5ALA_A Structure of Leishmania major peroxidase D211R mutant (low res) [Leishmania major],5ALA_B Structure of Leishmania major peroxidase D211R mutant (low res) [Leishmania major]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q6BIB1|CCPR2_DEBHA	0.0	227	654	1	428	Putative heme-binding peroxidase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / BCRC 21394 / JCM 1990 / NBRC 0083 / IGC 2968) OX=284592 GN=DEHA2G12166g PE=3 SV=3
sp|Q59X94|CCPR2_CANAL	6.84e-129	384	643	31	290	Putative heme-binding peroxidase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CCP2 PE=3 SV=2
sp|Q6CAB5|CCPR2_YARLI	4.62e-100	386	647	9	269	Putative cytochrome c peroxidase, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=YALI0D04268g PE=3 SV=1
sp|Q4HWQ2|CCPR2_GIBZE	3.43e-94	386	648	22	288	Putative heme-binding peroxidase OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=FGRRES_10606 PE=3 SV=1
sp|A4R606|CCPR2_MAGO7	3.48e-94	384	650	9	279	Putative heme-binding peroxidase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) OX=242507 GN=MGG_10368 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000024	0.000005

TMHMM  Annotations     

There is no transmembrane helices in CAG90546.2.