CAZyme Information: CAG90037.2

Basic Information

• Species: Debaryomyces hansenii
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Debaryomyces; Debaryomyces hansenii
• CAZyme ID: CAG90037.2
• CAZy Family: GT2|GT2
• CAZyme Description: DEHA2G01232p [Source:UniProtKB/TrEMBL;Acc:Q6BJN0]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1532		176414.01	4.8882

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_DhanseniiCBS767	6698	284592	426	6272

• Gene Location: location=CR382139:93294-97892(+)

Full Sequence      

MQLGCCLAICQFFLLSVVAFQDNDLSSAENKFEVNLEASWRPSPFQLNLLESISGYNESL
FINTLANIIGFSIEENESDEESNEELNDVDGTLISDSHIYMKVVDALNLDDTSKSFIGFN
LVNKIFTPRIQAHYEYYTNVVDPQFSHRLYKECSTDSFGNKILSGESDKHQAWILYNNKL
YCSSDEVFALKTDKKSTSTDDVLPFDRVIGSNQESPLLVLYGDIESEVFKNMFINLYESA
KIGKLRFVWRYIPSNNPDQREQLSGYGADITLKRTDYMVIDDRDINKIEFKNEKRIENKN
YHLDKGFSRIARLDELKPISKDNLTDLGLKLTSFILSNDYSDISNHDLLNSILQDFPKFA
YYVSQLDPENIDSVRESVNANVKLGMSEESNGIYINGSPINKLELDVLKLVDKVRDELKL
VNELKELGFTTGQAKKLLFKFALLSAVKESQFRTGNTIMGGNENRFKVYNYQFTPMSRHK
KGGVVFFNNIEKDDVYESFPSSRREAYLGFSAQHLRPGQIPIIRENIHDLIFALNFSDKE
QLKVFFTFSKIILDKSLPQQLGLIACGGNEKDKMIAEIFYFIVDKASLTEALAFLYKYFD
AKDEEAEKEILNAVSIPSTYSFNESIYQDVLDRFSINSPSVICNGVIYELTSTWQVLMGK
QLAQDIRLIQNHIQKGDDVNKSLKSFLFENAKSERNLRIIPNDASLIKYKGINQELIDNS
ISFKCKKKDNGASATFWLIGDFNSINILDQFVEILRTMKVERSYSIQVRILNKSTDTDLL
DKIKALFPINELRTKDIENIISWLSDRLHNSVNCKPDKNIVQLLEASGLPPNHPLLLLNG
RYFRLDKNLSFKELQQLLEYEFSQRLNLFGDIISAYPDEFPRSFCEYHSSRYDCSDWFDL
VSSYVTKSFHVDDNMLVSDVARFDFSSLNMDNILKISEDETSKEVEVLIIIDPIDEMSQK
LVSIIYAITSFPFVDIKILLQPQLEATEEVKIGRFYRGVYPSSIPQFGKDGGLEIKNKAV
FEMVPSQELFTTNIDSPARWQIVIHDSPSGVDLDNVKLSNYVDSLIYGTYVLKNILIEGY
AKNVKYGMNLSGLTIDLSKDNSYTDTTVMSNLGYFQLSANPGIWEFKIKPESKSEKYYSL
LSASENVFISNTDPLGSVRVAILNLNGLVLKPRFTTNSGYENKFIFEEDDNIESEDDNKI
GSFMKSLLKSKAPTTKKHADINIFTIASGHLYERFLSIMTASVMAHTDKSVKFWIIENYI
SSHFKKLLPLLAQEYNFEYELITYKWPNWLRFQREKQRTIWGYKILFLDVLFPQDLKKVI
FVDADQIARTDMKELVDLDLEGAPYGFTPMCDSRKDMEGFRFWKQGYWAHVLKDGLKYHI
SALYVVDLDKFRALSAGDRLRAHYQKLSSDPNSLSNLDQDLPNNMQNKIKIHSLPQEWLW
CETWCSDSEFRNAKTIDLCNNPLTKENKLDTAKRQIPEWTTYDNQIKRLMDQINDNENPK
ISTDVLENTPRNDLHDEDNQSQYEPDYIHDEL

Enzyme Prediction     

EC	2.4.1.-:29

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT24	1221	1469	1.2e-130	0.9959677419354839

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
408203	Glyco_transf_24	0.0	1221	1489	1	268	Glucosyltransferase 24. This is the catalytic domain found in UDP-glucose:glycoprotein glucosyltransferase (UGGT). This domain belongs to glucosyltransferase 24 family (GT24) A-type domain. The GT domain displays the expected glycosyltransferase type A (GT-A) fold.
133054	GT8_HUGT1_C_like	1.71e-163	1221	1469	1	248	The C-terminal domain of HUGT1-like is highly homologous to the GT 8 family. C-terminal domain of glycoprotein glucosyltransferase (UGT). UGT is a large glycoprotein whose C-terminus contains the catalytic activity. This catalytic C-terminal domain is highly homologous to Glycosyltransferase Family 8 (GT 8) and contains the DXD motif that coordinates donor sugar binding, characteristic for Family 8 glycosyltransferases. GT 8 proteins are retaining enzymes based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. The non-catalytic N-terminal portion of the human UTG1 (HUGT1) has been shown to monitor the protein folding status and activate its glucosyltransferase activity.
132996	Glyco_transf_8	2.48e-56	1221	1462	1	241	Members of glycosyltransferase family 8 (GT-8) are involved in lipopolysaccharide biosynthesis and glycogen synthesis. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. GT-8 comprises enzymes with a number of known activities: lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, glycogenin glucosyltransferase, and N-acetylglucosaminyltransferase. GT-8 enzymes contains a conserved DXD motif which is essential in the coordination of a catalytic divalent cation, most commonly Mn2+.
408201	Thioredoxin_14	1.48e-37	481	699	10	248	Thioredoxin-like domain. This is the third out of four TRXL(thioredoxin-like) domains found in UDP-glucose:glycoprotein glucosyltransferase (UGGT).
408199	Thioredoxin_12	1.68e-34	44	260	3	185	Thioredoxin-like domain. This is one of four TRXL(thioredoxin-like) domains found in UDP-glucose:glycoprotein glucosyltransferase (UGGT).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAG90037.2|GT24	0.0	1	1532	1	1532
ABN66217.2|GT24	0.0	29	1490	29	1475
CAC18923.1|GT24|2.4.1.-	0.0	12	1532	8	1447
AOW28327.1|GT24	0.0	12	1505	8	1422
CCE83152.1|GT24	0.0	29	1491	29	1462

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MU1_A	1.75e-203	27	1500	6	1457	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5MZO_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5N2J_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5N2J_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TRF_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
5NV4_A	1.75e-203	27	1500	6	1457	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TRT_A	6.65e-203	27	1500	6	1457	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TS2_A	1.88e-175	27	1500	6	1223	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_C Chain C, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_D Chain D, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TS8_A	5.81e-167	34	1431	6	1382	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS8_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q09140|UGGG_SCHPO	7.27e-196	105	1490	60	1425	UDP-glucose:glycoprotein glucosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gpt1 PE=1 SV=2
sp|Q09332|UGGG_DROME	1.57e-164	8	1498	6	1516	UDP-glucose:glycoprotein glucosyltransferase OS=Drosophila melanogaster OX=7227 GN=Uggt PE=1 SV=2
sp|Q6P5E4|UGGG1_MOUSE	2.07e-161	207	1489	185	1523	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Mus musculus OX=10090 GN=Uggt1 PE=1 SV=4
sp|Q9NYU2|UGGG1_HUMAN	1.55e-160	177	1489	154	1523	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=UGGT1 PE=1 SV=3
sp|Q9JLA3|UGGG1_RAT	6.70e-158	207	1489	185	1523	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Uggt1 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000239	0.999718	CS pos: 19-20. Pr: 0.9813

TMHMM  Annotations     

There is no transmembrane helices in CAG90037.2.