CAZyme Information: CAG87955.2

Basic Information

• Species: Debaryomyces hansenii
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Debaryomyces; Debaryomyces hansenii
• CAZyme ID: CAG87955.2
• CAZy Family: GH76
• CAZyme Description: DEHA2E09504p [Source:UniProtKB/TrEMBL;Acc:Q6BQ01]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
843		97184.79	5.3359

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_DhanseniiCBS767	6698	284592	426	6272

• Gene Location: location=CR382137:753676-756207(-)

Full Sequence      

MTMTSQTTYNTLSNWSYKRANKDSTKWQPCSKKTNGNQIHTDLLNNGEIPDPFIDRNEKD
LQWIGEEDWEYKTTFKVDSNKKHELVFEGLDTFATIYVNDKQVLTTDNMFRTYTLDVTNC
SQESNELRIVFKSALKVSRALEEKHGKFTCFNGETSRVHARKAQYHYGWDWGPLLLTCGP
WKPIKLVTYSTAKINDFYVKQSVDENLQAELSFEVEVESISDDCQLSIEIFSSAGKLIRT
IKESANKSYTFDPIKLEDPELWYPKGYGKQPLYKFVAKLHQTDQIIDSVVSEVGVRRARL
VQEPVKGQDGSSFYFEVNNIPIFCNGSNWIPSHSFSCSLIDDDYVDLIRLVDEGNQNMIR
VWGGGFYENDILYKQCDKLGILIWQDFMFGCAIYPGYKEFIDNVTHEVIDQLKRLRNYCS
IVFYVGNNEDYQVAEDLYKKNTFTDEEFPAKKLYERILPDMVSKLTSGVGYQFGSPISPG
QGVPTTDVTVGDIHQWNVWHGTQEKYQDWGKLVGRFVSEFGMLAFPDIKTLKDCITDEKQ
LYPQSETMDHHNKSIGFERRLALYVMENFSVSSMALADWIYITQLMQSDCLAYAYRNWKR
EWGSKNERKCGGALVWQINDCWPVTSWAIIDFYHRPKLAYYAIKRECQPLMLGIYRTETR
LRQPGEPDLEKQAPLHDYSPREYTIDVWGVNSTLQDFSGTLEVELYHCETGELVSNLEKS
KITLAPNQTTELVTKSKIDSNKLVVHAKLVDSASKLVSNTSDWPQPLKYIIWPKDTKLDV
SIPENGTIKLSTNKPVKGIALNIEGDYYLHDNSIDLLPNNDHYIKVDNLQSDDVAKISVN
YLK

Enzyme Prediction     

EC	3.2.1.25:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	7	741	5.2e-90	0.7007978723404256

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225789	LacZ	4.01e-70	28	644	26	627	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
407658	Mannosidase_ig	9.99e-16	684	769	2	91	Mannosidase Ig/CBM-like domain. This domain corresponds to domain 4 in the structure of Bacteroides thetaiotaomicron beta-mannosidase, BtMan2A. This domain has an Ig-like fold.
395572	Glyco_hydro_2	6.79e-13	192	296	1	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
236657	PRK10150	1.13e-05	51	315	53	294	beta-D-glucuronidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAG87955.2|GH2	0.0	1	843	1	843
ANB14378.1|GH2	1.84e-300	11	837	13	856
SGZ48501.1|GH2	4.88e-287	11	841	6	832
SGZ52529.1|GH2	4.88e-287	11	841	6	832
QPG76551.1|GH2	5.28e-283	12	835	11	847

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5N6U_A	1.52e-142	39	702	52	684	Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_B Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_C Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_D Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12]
2VJX_A	4.31e-119	15	653	15	657	Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]
2JE8_A	4.52e-119	15	653	17	659	Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JE8_B Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
7OP6_A	4.63e-119	15	653	17	659	Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP6_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_A Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482]
2WBK_A	1.21e-118	15	653	15	657	Structure of the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482],2WBK_B Structure of the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|I2C092|MANBB_THETO	2.94e-229	14	842	12	852	Beta-mannosidase B OS=Thermothelomyces thermophilus OX=78579 GN=man9 PE=1 SV=1
sp|Q5B7W2|MANBB_EMENI	6.21e-199	15	833	13	833	Beta-mannosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=mndB PE=1 SV=2
sp|Q0CCA0|MANBB_ASPTN	3.90e-197	15	832	13	832	Beta-mannosidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=mndB PE=3 SV=2
sp|A2QYN2|MANBB_ASPNC	2.00e-194	39	836	36	838	Beta-mannosidase B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=mndB PE=3 SV=1
sp|A1CGA8|MANBB_ASPCL	4.11e-194	15	833	13	835	Beta-mannosidase B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=mndB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000044	0.000000

TMHMM  Annotations     

There is no transmembrane helices in CAG87955.2.