CAZyme Information: CAG87426.1

Basic Information

• Species: Debaryomyces hansenii
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Debaryomyces; Debaryomyces hansenii
• CAZyme ID: CAG87426.1
• CAZy Family: GH63
• CAZyme Description: DEHA2D17600p [Source:UniProtKB/TrEMBL;Acc:Q6BRB8]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
400	CR382136|CGC1	45780.65	5.9561

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_DhanseniiCBS767	6698	284592	426	6272

• Gene Location: location=CR382136:1460111-1461313(-)

Full Sequence      

MSLTNPNLEGYHVVRNMWMLYYNKSENNYIAPKKCSGCYDDKKFVIWSVSVASQAIVDAA
RIYKEFVPLVDPAIHIFSKYKNNHLKGYSAAENAGTDEDIYYDDDAQVASAMITAYEVTG
NKKHLDQGRELVRFLMGGWNTNPDAKTKGGMKWHLKNAYLNSCTTGETAKACLQISKFIP
NEAKIYVDFAAKCIDWQIKVLRSEDDGLIMDGIQDTATDVNDTKYSYNTGTTLSAASLLY
NITKETKWKDIADDLAKAAINRNVFFYDRDYSDDKRYWRDASYFVQLLIEGLADYLLYIG
NEAPEGLPQRIEEEIKRHLVMFYKYMRDPNDGLYIQSFEPHLTYRDVYDSKYKQEFGERK
GWSLKNEDKDGDGNPQKCLIGCGSAARVFFQGARVVPKID

Enzyme Prediction     

No EC number prediction in CAG87426.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	12	319	2.4e-52	0.7960893854748603

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397638	Glyco_hydro_76	6.52e-41	13	294	9	290	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.
227170	COG4833	4.22e-10	82	262	72	246	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAG87426.1|GH76	1.92e-306	1	400	1	400
CCE73401.1|GH76	9.94e-231	1	400	1	398
CCE72840.1|GH76	9.94e-231	1	400	1	398
AOW28251.1|GH76	2.17e-217	3	400	6	403
CCE44696.1|GH76	4.44e-212	2	400	6	404

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4C1S_A	4.82e-18	85	259	92	268	Glycoside hydrolase family 76 (mannosidase) Bt3792 from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482],4C1S_B Glycoside hydrolase family 76 (mannosidase) Bt3792 from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482]
6U4Z_A	9.64e-11	88	259	219	392	Crystal Structure of a family 76 glycoside hydrolase from a bovine Bacteroides thetaiotaomicron strain [Bacteroides thetaiotaomicron]
3K7X_A	1.47e-09	93	290	82	281	Chain A, Lin0763 protein [Listeria innocua]
4BOK_A	3.32e-06	101	264	88	246	Chain A, Alpha-1,6-mannanase [Niallia circulans]
4BOJ_A	3.35e-06	101	264	91	249	Chain A, Alpha-1,6-mannanase [Niallia circulans],4BOJ_B Chain B, Alpha-1,6-mannanase [Niallia circulans],4BOJ_C Chain C, Alpha-1,6-mannanase [Niallia circulans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O14131|MU191_SCHPO	9.22e-38	9	398	9	416	Meiotically up-regulated gene 191 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mug191 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000050	0.000000

TMHMM  Annotations     

There is no transmembrane helices in CAG87426.1.