CAZyme Information: CAG87189.1

Basic Information

• Species: Debaryomyces hansenii
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Debaryomyces; Debaryomyces hansenii
• CAZyme ID: CAG87189.1
• CAZy Family: GH37
• CAZyme Description: GPI mannosyltransferase 2 [Source:UniProtKB/Swiss-Prot;Acc:Q6BRZ9]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
428		49933.73	8.5706

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_DhanseniiCBS767	6698	284592	426	6272

• Gene Location: location=CR382136:1067604-1068890(+)

Full Sequence      

MKDISVIVKYFVLFKSIQLIIVYFTPVQFDTSSQLIIEKYRNDKLQVLSDWKLPFQISDS
ILSNIIDKFITWDAVYFSDLFLNDIKYEHQFVFCPLWWRIIKWIPIGEGNYYKKLMLGML
CSNICHLGTCIILYYLTFEMFKTSSLFTKTLREFSLISSIIYIISPAGIFLTASYSESPC
ALFSMASIYLREISINRENFNHLNSKNSLKTHWIYKVTYLLSGTMVSIAYGIRGNCLLLG
AMFLFDLYEFGIRNRDITDSILSLVSGGQIFVSIIALNWYTYAIFCPARGEWCQSWIPSL
FSYAQSHYWNVGFFNYWSLANIPNFLFALPTIVLTLQSFKHFTEEKPVKNLLPVMIVNGM
LLVGAVFWWHVQILTRISSFLPLMYWFVASMWISDSPTYKRYSENTMKFMIGWNLIQTSM
FAAFLPPA

Enzyme Prediction     

No EC number prediction in CAG87189.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT76	7	428	2e-105	0.9975429975429976

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
282094	Mannosyl_trans2	3.04e-41	7	428	4	439	Mannosyltransferase (PIG-V). This is a family of eukaryotic ER membrane proteins that are involved in the synthesis of glycosylphosphatidylinositol (GPI), a glycolipid that anchors many proteins to the eukaryotic cell surface. Proteins in this family are involved in transferring the second mannose in the biosynthetic pathway of GPI.
227829	COG5542	1.02e-19	10	428	6	408	Mannosyltransferase related to Gpi18 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAG87189.1|GT76	0.0	1	428	1	428
XP_459021.1|GT76	0.0	1	428	1	428
CCE83209.1|GT76	5.53e-161	1	428	1	426
CCE84240.1|GT76	5.53e-161	1	428	1	426
QEL58691.1|GT76	2.53e-112	1	428	1	423

PDB Hits     

CAG87189.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q6BRZ9|GPI18_DEBHA	0.0	1	428	1	428	GPI mannosyltransferase 2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / BCRC 21394 / JCM 1990 / NBRC 0083 / IGC 2968) OX=284592 GN=GPI18 PE=3 SV=1
sp|Q59VN0|GPI18_CANAL	2.77e-104	9	428	7	394	GPI mannosyltransferase 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=GPI18 PE=3 SV=1
sp|P38211|GPI18_YEAST	9.71e-67	10	428	8	433	GPI mannosyltransferase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GPI18 PE=1 SV=2
sp|Q6CMW6|GPI18_KLULA	5.03e-56	15	428	21	417	GPI mannosyltransferase 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 GN=GPI18 PE=3 SV=1
sp|Q6C216|GPI18_YARLI	6.05e-56	1	428	1	357	GPI mannosyltransferase 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=GPI18 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.936101	0.063908

TMHMM  Annotations     

Start	End
7	29
116	138
151	173
226	248
261	283
317	339
351	373