CAZyme Information: CAG86543.1

Basic Information

• Species: Debaryomyces hansenii
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Debaryomyces; Debaryomyces hansenii
• CAZyme ID: CAG86543.1
• CAZy Family: GH17
• CAZyme Description: DEHA2C17644p [Source:UniProtKB/TrEMBL;Acc:Q6BTK8]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
414	CR382135|CGC4	47116.23	5.4970

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_DhanseniiCBS767	6698	284592	426	6272

• Gene Location: location=CR382135:1560008-1561252(+)

Full Sequence      

MTKETSAQIYLDEIKDKLYGDSTVAKIWGVASPALSQQEPPTGFPNYAPDGKYVLDDADY
WTSGFFPGSVYALLERSKNYPDFFPKSKIHEVKLEYAARWWAEPMAARATTTTTHDLGFM
IAPAFKREWVLTNSKKSEEILITAANSLASRFDEKVGCIRSWDDLPPIKKDQKPKDINKD
FLVIIDNMCNLNLLYLGAYLSRDFRLSTIATKHAETTLKNHFRDDWSSYHVVQYNKQTGE
VDSKYTAQGFADESGWTRGQAWGILGYIETYFWTKDRKFLEASKNIANYYVSKLPEDGVP
PWDFNAPDKHIRDVSSAMAAALGMIRIYEVEKDEEFLKKGLKLVRDCINLSYNNDAKLND
DGTVEIGAAETILNNSTYIHNPACSVDIYDHGLVYADYYFLVIGNKLLQLGLYK

Enzyme Prediction     

No EC number prediction in CAG86543.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH88	56	401	6.8e-105	0.9696048632218845

CDD Domains     

CAG86543.1 has no CDD domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAG86543.1|GH88	4.14e-317	1	414	1	414
CAG86548.1|GH88	3.34e-208	8	414	4	413
CAR65600.1|GH88	1.12e-200	6	414	2	408
CAG86594.1|GH88	1.96e-187	8	413	4	407
CAG87553.1|GH88	3.08e-170	5	412	4	409

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3WIW_A	7.45e-48	49	401	61	382	Crystal structure of unsaturated glucuronyl hydrolase specific for heparin [Pedobacter heparinus DSM 2366]
2ZZR_A	2.91e-40	53	401	60	383	Crystal structure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae]
3ANJ_A	2.96e-40	53	401	61	384	Crystal structure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae serogroup III]
3WUX_A	7.95e-40	53	401	61	384	Crystal structure of unsaturated glucuronyl hydrolase mutant D115N/K370S from Streptococcus agalactiae [Streptococcus agalactiae NEM316]
3ANI_A	1.53e-39	53	401	61	384	Crystal structure of unsaturated glucuronyl hydrolase mutant D175N from Streptcoccus agalactiae [Streptococcus agalactiae serogroup III],3ANK_A Crystal structure of unsaturated glucuronyl hydrolase mutant D175N from Streptcoccus agalactiae complexed with dGlcA-GalNAc6S [Streptococcus agalactiae serogroup III]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|T2KLZ3|PLH1_FORAG	3.24e-50	48	401	65	388	Unsaturated glucuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21900 PE=1 SV=1
sp|Q8DR77|UCDH_STRR6	1.44e-41	50	401	56	382	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=ugl PE=1 SV=1
sp|Q9A0T3|UCDH_STRP1	2.15e-40	50	401	59	385	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pyogenes serotype M1 OX=301447 GN=ugl PE=1 SV=1
sp|Q8E372|UCDH_STRA3	1.52e-39	53	401	61	384	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus agalactiae serotype III (strain NEM316) OX=211110 GN=gbs1889 PE=1 SV=1
sp|Q9RC92|UGL_BACGL	2.60e-34	44	401	24	358	Unsaturated glucuronyl hydrolase OS=Bacillus sp. (strain GL1) OX=84635 GN=ugl PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999997	0.000052

TMHMM  Annotations     

There is no transmembrane helices in CAG86543.1.