CAZyme Information: CAG86368.1

Basic Information

• Species: Debaryomyces hansenii
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Debaryomyces; Debaryomyces hansenii
• CAZyme ID: CAG86368.1
• CAZy Family: GH17
• CAZyme Description: DEHA2C14058p [Source:UniProtKB/TrEMBL;Acc:Q6BU29]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
384	CR382135|CGC13	39820.11	4.3497

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_DhanseniiCBS767	6698	284592	426	6272

• Gene Location: location=CR382135:1232380-1233534(-)

Full Sequence      

MKYSVLTVLALATASLAAPLEGHKHHQHQHKRDSVVKQVTQVVYVDSNGNPVTSSGTAAS
TQASQGTGSATTLSTITSSSASSSEAASSSASETDSGSSSTGGSSSGSSGISGDLKAFSD
PTDKFEDGKYKCSEVPTGQGVIAVDWISGLNGGWTSIMNEDGDTSSNCQDGYYCSYACQA
GMSKTQWPSEQPSSGISVGGLYCKGGYLYKSNSDQDYLCSWGEQSAEFSSEISKDIAICR
TDYPGSENMNIPTLLEGGNTAPASVVDSAEYYTWKGGKTSTQYYVNNAGVTVEDGCIWGT
EGSGVGNWAPVVLGAGVTDGKTYLSLIPNPNNQDSPNYNVKIVGESGADVNGDCKYENGS
YNGKGTDGCTVTVSSGKAKFVFYN

Enzyme Prediction     

No EC number prediction in CAG86368.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH132	82	383	3.7e-125	0.9702970297029703

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397780	SUN	4.68e-130	127	370	1	244	Beta-glucosidase (SUN family). Members of this family include Nca3, Sun4 and Sim1. This is a family of yeast proteins, involved in a diverse set of functions (DNA replication, aging, mitochondrial biogenesis and cell septation). BGLA from Candida wickerhamii has been characterized as a Beta-glucosidase EC:3.2.1.21.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAG86368.1|GH132	4.37e-247	1	384	1	384
EAZ62917.1|GH132	4.66e-171	1	383	1	360
CCE42652.1|GH132	5.13e-169	1	383	1	384
CCG23148.1|GH132	3.28e-168	1	383	1	387
CAX45649.1|GH132	1.01e-165	1	383	1	371

PDB Hits     

CAG86368.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5AKU5|UTH1_CANAL	5.32e-166	1	383	1	372	Secreted beta-glucosidase SIM1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SIM1 PE=1 SV=1
sp|Q59NP5|SUN41_CANAL	1.94e-125	113	384	149	418	Secreted beta-glucosidase SUN41 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SUN41 PE=1 SV=2
sp|P40472|SIM1_YEAST	4.42e-125	113	384	207	476	Probable secreted beta-glucosidase SIM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SIM1 PE=1 SV=2
sp|B3LRC2|UTH1_YEAS1	2.81e-124	125	383	106	362	Probable secreted beta-glucosidase UTH1 OS=Saccharomyces cerevisiae (strain RM11-1a) OX=285006 GN=UTH1 PE=3 SV=1
sp|A7A003|UTH1_YEAS7	2.81e-124	125	383	106	362	Probable secreted beta-glucosidase UTH1 OS=Saccharomyces cerevisiae (strain YJM789) OX=307796 GN=UTH1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000218	0.999758	CS pos: 17-18. Pr: 0.9783

TMHMM  Annotations     

There is no transmembrane helices in CAG86368.1.