CAZyme Information: CAG85284.2

Basic Information

• Species: Debaryomyces hansenii
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Debaryomyces; Debaryomyces hansenii
• CAZyme ID: CAG85284.2
• CAZy Family: CE9
• CAZyme Description: Beta-glucosidase [Source:UniProtKB/TrEMBL;Acc:Q6BWY6]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
904		100050.25	5.6052

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_DhanseniiCBS767	6698	284592	426	6272

• Gene Location: location=CR382134:590321-593035(-)

Full Sequence      

MITKRCLHILNRKCTRIHFSSVSFLNMEFDPDHNYLVFVDIKGGPSCKSTNNCKKTTGYY
HIVQLLIMSEFNIESTLAQLTLQEKIGLLAGIDFWHTFAVERLNIPSLRFSDGPNGLRGT
KFFDSVPSACFPCGTALAATFDKELLFEAGRLMGDEAKHKGAQVVLGPTMNIQRGPLGGR
GFESFSEDAHLTGQSAASIINGIQDKGIAATIKHFVCNDLEDQRNSSDSILTERALREIY
LEPFRLAIKHSNPVALMTGYNKVNGEHVSQSERLIQDILRKEWDWDGTTMSDWYGTYTSK
EAIENGLDIEMPGPSIFRNQSEVAAMVTTKELHIKKIDERVTNVLKLIKYALKSGVPENA
PETSNGNTPETAALLRKLAHDSVVLLKNDNNVLPLSKDDKIAVIGPNAKFAAYCGGGSAS
LRAYYTTTPFDSISKKLNKDPEYTIGAYGHRLLPALGPQLVNPKTGNAGYNLKYYLEPKS
TSERTLIDERDLDLSNIFLVDYYNKKIKDDLFFIDFDGQFTPEETADYEFGLAVLGTAQL
FVDGKLVVDNKTVQQRGNSFFNSGSNEVRNSISLEKGKTYSIKIEFGSAPTFTVPSHDSV
SFGGGGGINLGLAKVINPKDEIAKAAELAKKVDKVVLNIGLNQEWESEGFDRPDMKLIGH
INELVDAVLDANPNTVVVNQSGTPVEFPWIKKANALVQAWYGGNELGNGIADVLFGDVNP
SGKLSLSFPVKNVDNPAYLNFKTEKGRVLYGEDIFVGYKYYEKLEREVAFPFGFGLSYTK
FDISGSKVSVDEKDDNLTVSVNVKNTGKIDGSEVVQFYISKDESDVIRPVKELKGFEKVH
LKAGADSTVSLKLSLKDSISFFDEYQDEWSVEKGDYKVHVGNSSDNITSTLPFKIEKDFL
WSGM

Enzyme Prediction     

EC	3.2.1.21:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	99	312	3.5e-61	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	2.67e-77	131	889	120	759	beta-glucosidase BglX.
224389	BglX	2.13e-69	62	409	7	365	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	3.41e-53	383	758	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
178629	PLN03080	4.95e-41	75	851	55	740	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	3.30e-32	131	347	88	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAG85284.2|GH3	0.0	1	904	1	904
ABN67130.1|GH3	0.0	71	903	6	838
CCE84110.1|GH3	0.0	68	903	1	833
CCE85141.1|GH3	0.0	68	903	1	833
QFZ32656.1|GH3	0.0	68	904	1	837

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3ABZ_A	0.0	69	904	2	845	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
3AC0_A	0.0	68	904	1	845	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
7MS2_A	5.47e-140	72	887	4	660	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	5.16e-110	68	898	1	666	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	4.87e-95	73	898	4	716	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P07337|BGLS_KLUMA	0.0	68	904	1	845	Beta-glucosidase OS=Kluyveromyces marxianus OX=4911 PE=3 SV=1
sp|A1CA51|BGLI_ASPCL	7.44e-303	68	904	1	838	Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglI PE=3 SV=1
sp|Q9P6J6|BGLS_SCHPO	3.44e-302	68	904	1	832	Putative beta-glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1683.04 PE=3 SV=1
sp|Q2U8Y5|BGLI_ASPOR	1.43e-300	68	904	1	839	Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglI PE=3 SV=1
sp|Q4WU49|BGLI_ASPFU	7.89e-300	68	904	1	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000083	0.000000

TMHMM  Annotations     

There is no transmembrane helices in CAG85284.2.