CAZyme Information: C6_03340C_B-T-p1

Basic Information

• Species: Candida albicans
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; Candida albicans
• CAZyme ID: C6_03340C_B-T-p1
• CAZy Family: GT4
• CAZyme Description: Putative 1,4-glucan branching enzyme, fluconazole-induced, colony morphology-related gene regulation by Ssn6, stationary phase enriched protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
684		78617.94	6.2931

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CalbicansSC5314_B	6415	N/A	215	6200

• Gene Location: location=Ca22chr6B_C_albicans_SC5314:700155-702209(-)

Full Sequence      

MSKSLIQGVLDLDPWLEPFSQPLINRQIEFQKWHKKLIESEGSLIDFANSYKKYGVHTLP
SGEIQIIQYIPDVDEVSIVGDFNNWNKDSHKLRKLNEFGTWELTLKPGSIPIDSKYKIAM
KTTTTTTTTTTTKNGGEWIYRLDPWVHRATFAKQHALYEGHFWEDNYQFKNPRPKKNIAA
GGIKIYEAHVGISTPEPTIGSYKNFTQNVLPIIRDLGYNTIQLMAIMEHAYYASFGYQVT
SFFAISSRYGTPDELKELIDTAHGMGIQVLLDVVHSHSSKNVDDGLNMFNGTDHYLFHGG
SRGNHDLWDSRLFNYTNYETLRFLLSNLKYYIDVFQFDGFRFDGVTSMLYKHHGLSVGFS
GGYHEYFGDGVDNEAIVYLMLAHQLMNEISTTQNFNLTSIAEDVSGMPTLCRPISDGGIG
FNYRLSMAIPDMWIKILKHLTDEQWDLGNIVHTLTNRRYGEKVIAYCESHDQALVGDKTL
AFWLMDKEMYTNMSVLSPLTPIIDRGIALHKLIRLVTFALGGDGYLNFEGNEFGHPEWLD
FPRQGNGESYHYARRQFNLINDDLLRYKYLYQFDKKMLQLEITNTGEYVSLKHEGDKVLV
FEKGKSVYIFNFNPTQSFVDYRIGVELPGTYKLVLDSDSEDLGGHGRLDHNTKYFTFNEP
WNNRSNSLLVYIPTRTAIVLEKVE

Enzyme Prediction     

EC	2.4.1.18:166	2.4.1.18:50

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH13	234	531	2.9e-145	0.9965870307167235

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
215246	PLN02447	0.0	7	684	60	732	1,4-alpha-glucan-branching enzyme
200460	AmyAc_bac_euk_BE	0.0	164	575	2	406	Alpha amylase catalytic domain found in bacterial and eukaryotic branching enzymes. Branching enzymes (BEs) catalyze the formation of alpha-1,6 branch points in either glycogen or starch by cleavage of the alpha-1,4 glucosidic linkage yielding a non-reducing end oligosaccharide chain, and subsequent attachment to the alpha-1,6 position. By increasing the number of non-reducing ends, glycogen is more reactive to synthesis and digestion as well as being more soluble. This group includes bacterial and eukaryotic proteins. The Alpha-amylase family comprises the largest family of glycoside hydrolases (GH), with the majority of enzymes acting on starch, glycogen, and related oligo- and polysaccharides. These proteins catalyze the transformation of alpha-1,4 and alpha-1,6 glucosidic linkages with retention of the anomeric center. The protein is described as having 3 domains: A, B, C. A is a (beta/alpha) 8-barrel; B is a loop between the beta 3 strand and alpha 3 helix of A; C is the C-terminal extension characterized by a Greek key. The majority of the enzymes have an active site cleft found between domains A and B where a triad of catalytic residues (Asp, Glu and Asp) performs catalysis. Other members of this family have lost the catalytic activity as in the case of the human 4F2hc, or only have 2 residues that serve as the catalytic nucleophile and the acid/base, such as Thermus A4 beta-galactosidase with 2 Glu residues (GH42) and human alpha-galactosidase with 2 Asp residues (GH31). The family members are quite extensive and include: alpha amylase, maltosyltransferase, cyclodextrin glycotransferase, maltogenic amylase, neopullulanase, isoamylase, 1,4-alpha-D-glucan maltotetrahydrolase, 4-alpha-glucotransferase, oligo-1,6-glucosidase, amylosucrase, sucrose phosphorylase, and amylomaltase.
215519	PLN02960	3.74e-163	162	679	374	888	alpha-amylase
178782	PLN03244	1.90e-135	164	679	385	863	alpha-amylase; Provisional
223373	GlgB	8.00e-124	50	681	22	627	1,4-alpha-glucan branching enzyme [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOW30264.1|CBM48|GH13_8	0.0	1	684	1	684
CAX41245.1|CBM48|GH13_8	0.0	1	684	1	677
CCE39640.1|CBM48|GH13_8	0.0	2	684	3	682
CCG25338.1|CBM48|GH13_8	0.0	3	684	4	682
ABN65252.2|CBM48|GH13_8	0.0	2	681	5	694

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4BZY_A	1.29e-275	9	684	31	699	Crystal structure of human glycogen branching enzyme (GBE1) [Homo sapiens],4BZY_B Crystal structure of human glycogen branching enzyme (GBE1) [Homo sapiens],4BZY_C Crystal structure of human glycogen branching enzyme (GBE1) [Homo sapiens]
5CLT_A	1.68e-272	16	684	6	667	Crystal structure of human glycogen branching enzyme (GBE1) in complex with acarbose [Homo sapiens],5CLT_B Crystal structure of human glycogen branching enzyme (GBE1) in complex with acarbose [Homo sapiens],5CLT_C Crystal structure of human glycogen branching enzyme (GBE1) in complex with acarbose [Homo sapiens],5CLW_A Crystal structure of human glycogen branching enzyme (GBE1) in complex with maltoheptaose [Homo sapiens],5CLW_B Crystal structure of human glycogen branching enzyme (GBE1) in complex with maltoheptaose [Homo sapiens],5CLW_C Crystal structure of human glycogen branching enzyme (GBE1) in complex with maltoheptaose [Homo sapiens]
3AMK_A	1.58e-241	9	684	13	694	Structure of the Starch Branching Enzyme I (BEI) from Oryza sativa L [Oryza sativa Japonica Group]
3VU2_A	4.48e-241	9	684	13	694	Structure of the Starch Branching Enzyme I (BEI) complexed with maltopentaose from Oryza sativa L [Oryza sativa Japonica Group],3VU2_B Structure of the Starch Branching Enzyme I (BEI) complexed with maltopentaose from Oryza sativa L [Oryza sativa Japonica Group]
3AML_A	9.56e-241	9	684	13	694	Structure of the Starch Branching Enzyme I (BEI) from Oryza sativa L [Oryza sativa Japonica Group]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q6BXN1|GLGB_DEBHA	0.0	2	684	14	708	1,4-alpha-glucan-branching enzyme OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / BCRC 21394 / JCM 1990 / NBRC 0083 / IGC 2968) OX=284592 GN=GLC3 PE=3 SV=1
sp|Q6FJV0|GLGB_CANGA	7.79e-292	6	682	10	704	1,4-alpha-glucan-branching enzyme OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) OX=284593 GN=GLC3 PE=3 SV=1
sp|Q6CCT1|GLGB_YARLI	2.13e-290	13	682	9	684	1,4-alpha-glucan-branching enzyme OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=GLC3 PE=3 SV=1
sp|Q8NKE1|GLGB_RHIID	3.78e-284	8	680	15	680	1,4-alpha-glucan-branching enzyme OS=Rhizophagus irregularis (strain DAOM 181602 / DAOM 197198 / MUCL 43194) OX=747089 GN=GLC3 PE=2 SV=2
sp|Q6T308|GLGB_FELCA	6.68e-284	9	684	28	696	1,4-alpha-glucan-branching enzyme OS=Felis catus OX=9685 GN=GBE1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000042	0.000000

TMHMM  Annotations     

There is no transmembrane helices in C6_03340C_B-T-p1.