CAZyme Information: C6_02940C_B-T-p1

Basic Information

• Species: Candida albicans
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; Candida albicans
• CAZyme ID: C6_02940C_B-T-p1
• CAZy Family: GT39
• CAZyme Description: Protein of unknown function, Spider biofilm repressed

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
432		49879.32	6.4377

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CalbicansSC5314_B	6415	N/A	215	6200

• Gene Location: location=Ca22chr6B_C_albicans_SC5314:606514-607812(-)

Full Sequence      

MLSAELKRRKKLLLPLALISGIIVLVFFTNYNYSFTTSSHPVLSSSHKSNNAFPTLDQTS
STKARPNPGNLIANQNDKSTTGTYFTKFIHKDPQFDFTKITYTSTNKKFKTNNIKVDEET
GDTTEVVNKPTVLIMSVIGNNEPYGSDRHFDGFMLTILSLVENQPDYEFSLGLLNNNEEE
FIKIQDYFEKNLQKELSETLSSIFKSISLISAPFLDQNTGFSREQRHDDHVQRLRRRLIA
KSRNFLLLNTLNLEQYVLSLDADMIRFDNPEKFIKAFIDSKKDIIVPRIQRLDMQDYDKN
SWRGQRTKPTKEQLEKMDNNQWDQWDYVPRDVKDHMYHFQTYMDNKDNEYELHKEEYDYV
VPLDSVGGAVLFAKSIVFKQGVIFPTSLIVGTTWDRQEGYDGIETEGVCYLAKPLGFSCW
GMPNVVAHHSGG

Enzyme Prediction     

No EC number prediction in C6_02940C_B-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT62	110	386	1.4e-69	0.9776119402985075

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397491	Anp1	5.68e-63	108	386	4	263	Anp1. The members of this family (Anp1, Van1 and Mnn9) are membrane proteins required for proper Golgi function. These proteins co-localize within the cis Golgi, and that they are physically associated in two distinct complexes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOW30225.1|GT62	7.76e-295	1	432	1	432
CAX41206.1|GT62	3.02e-268	1	432	1	437
ABN65744.2|GT62	1.07e-119	78	430	42	386
CCG25325.1|GT62	1.08e-108	78	429	103	451
CCE39652.1|GT62	6.27e-108	78	429	103	452

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3ZF8_A	1.39e-06	224	429	108	299	Crystal structure of Saccharomyces cerevisiae Mnn9 in complex with GDP and Mn. [Saccharomyces cerevisiae S288C]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P53697|MNN9_CANAL	1.67e-07	204	429	155	365	Mannan polymerase complex subunit MNN9 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN9 PE=3 SV=1
sp|P23642|VAN1_YEAST	2.33e-07	198	429	298	511	Mannan polymerase I complex VAN1 subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=VAN1 PE=1 SV=3
sp|Q00314|VAN1_CANAX	8.30e-07	204	429	211	418	Vanadate resistance protein OS=Candida albicans OX=5476 GN=VAN1 PE=3 SV=1
sp|P39107|MNN9_YEAST	2.33e-06	224	429	198	389	Mannan polymerase complexes subunit MNN9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNN9 PE=1 SV=3
sp|O74745|ANP1_SCHPO	2.51e-06	226	429	185	371	Mannan polymerase II complex anp1 subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=anp1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999990	0.000022

TMHMM  Annotations     

Start	End
12	34