CAZyme Information: C6_00820W_A-T-p1

Basic Information

• Species: Candida albicans
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; Candida albicans
• CAZyme ID: C6_00820W_A-T-p1
• CAZy Family: GT34
• CAZyme Description: Secreted beta-glucosidase SUN41 [Source:UniProtKB/Swiss-Prot;Acc:Q59NP5]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
418	Ca22chr6A_C_albicans_SC5314|CGC2	43692.77	4.4595

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CalbicansSC5314	6468	237561	256	6212

• Gene Location: location=Ca22chr6A_C_albicans_SC5314:158273-159529(+)

Full Sequence      

MRFSQATVLAFAALSLAAPAFEADNKNIKREDCDKTSFHGHHKHKRAVAYDYAYVTVTVD
GNGNPITTVSPVLSIETIAKSEETSSTSTSISSTTTIVQNDSLTSDEPKTLSLPSGTIKP
SSFATESQSQSQSSSTGGSGSGSTNGIEGDLAAFEDPTEEFEDGVLSCSDFPSGQGVIPL
DHLGFGGWSGIENSDGSTGGNCKEGSYCSYACQSGMSKTQWPEDQPSNGVSIGGLLCKNG
KLYKSSTRSNYLCEWGVKKANVVNKLSETVAICRTDYPGTENMVIPTVVGGGSTSVITVV
DQSTYYTWRGGATSAQYYVNNAGVSWEDGCVWGTPGSGVGNWAPLNFGAGYANGIAYLSL
IPNPNNRDSLNFKVKIVGESGSTVSGSCSYANGKFNGNSDDGCTVGVTSGEADFVLYN

Enzyme Prediction     

No EC number prediction in C6_00820W_A-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH132	126	417	3.9e-126	0.9471947194719472

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397780	SUN	7.70e-146	163	404	1	244	Beta-glucosidase (SUN family). Members of this family include Nca3, Sun4 and Sim1. This is a family of yeast proteins, involved in a diverse set of functions (DNA replication, aging, mitochondrial biogenesis and cell septation). BGLA from Candida wickerhamii has been characterized as a Beta-glucosidase EC:3.2.1.21.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOW30028.1|GH132	2.97e-269	1	418	1	418
CAX41028.1|GH132	7.58e-224	1	418	1	420
CCG24630.1|GH132	2.25e-185	1	418	1	420
CCE39890.1|GH132	1.47e-181	1	418	1	431
ABN67031.2|GH132	5.63e-169	143	418	115	390

PDB Hits     

C6_00820W_A-T-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q59NP5|SUN41_CANAL	5.27e-270	1	418	1	418	Secreted beta-glucosidase SUN41 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SUN41 PE=1 SV=2
sp|P40472|SIM1_YEAST	3.51e-136	147	418	205	476	Probable secreted beta-glucosidase SIM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SIM1 PE=1 SV=2
sp|P53616|SUN4_YEAST	1.03e-134	143	418	145	420	Probable secreted beta-glucosidase SUN4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUN4 PE=1 SV=1
sp|Q5AKU5|UTH1_CANAL	1.38e-120	145	417	101	372	Secreted beta-glucosidase SIM1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SIM1 PE=1 SV=1
sp|B3LRC2|UTH1_YEAS1	1.13e-119	160	417	105	362	Probable secreted beta-glucosidase UTH1 OS=Saccharomyces cerevisiae (strain RM11-1a) OX=285006 GN=UTH1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000303	0.999679	CS pos: 22-23. Pr: 0.6553

TMHMM  Annotations     

There is no transmembrane helices in C6_00820W_A-T-p1.