CAZyme Information: C5_04110W_B-T-p1

Basic Information

• Species: Candida albicans
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; Candida albicans
• CAZyme ID: C5_04110W_B-T-p1
• CAZy Family: GT22
• CAZyme Description: Cell wall protein, repressed in ace2 mutant, repressed in core caspofungin response, induced in high iron, possibly an essential gene, disruptants not obtained by UAU1 method, rat catheter and Spider biofilm repressed

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
506		54421.45	4.0522

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CalbicansSC5314_B	6415	N/A	215	6200

• Gene Location: location=Ca22chr5B_C_albicans_SC5314:916964-918484(+)

Full Sequence      

MFSNIISTLALLQLLNAAPILLTRYHVAAPTTEIKTVTTGTTTVWLPPVGIYISDGQTST
STITDAQWNTYPVTFTSIINKDQAAPTQQTTEAQQQQPTTTTTSSTSPAQPTTTETQQQQ
QQQQQPTTTEQAQPTTTEQQPQQPTTTEQQQQQQPTTTEQAQPTTTSTEQAPQSTEQGQQ
QGQPTTTEQTSQTTEQGQQTTEQNDTTTQSPSTTTIDYTSSTSSTSTSSPNPSSSIGSSG
DIPAPTAIVYSPYANDRSCKSADTIRSDIQLINSKGIKQIRSYGTDCGSLTTVLETCREL
GITVNQGVWISAAGVDSIDDQVSDVIKYGQSNGWDVFNLLTIGNEAIIAGYVSPSELVSK
IKSVKSQLQSAGYNGKVTTSEPPATYLKYPSFCTDADIDVVGINPHSYFNANIEPKDAGS
YIVHQQQQVAEICGGKSVLITETGYPSKGSTLGVNVPSPENQEIAISSIIKETGGDCTIL
TTYNDFWKDPGPYGIEQYFGVIQLFQ

Enzyme Prediction     

No EC number prediction in C5_04110W_B-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	267	502	3.3e-21	0.9067524115755627

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	1.24e-73	245	502	45	301	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOW29820.1|GH17	9.03e-255	1	506	1	506
CAX41759.1|GH17	2.48e-224	1	506	1	489
ABU33874.1|GH17	1.51e-196	216	506	34	324
CCE43991.1|GH17	2.89e-147	5	505	4	462
CCG21949.1|GH17	1.76e-143	5	505	4	473

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	1.45e-16	255	502	45	282	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]
4WTR_A	8.73e-16	255	502	45	282	Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaribiose [Rhizomucor miehei CAU432],4WTS_A Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaritriose [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P53189|SCW11_YEAST	2.10e-97	244	505	280	541	Probable family 17 glucosidase SCW11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SCW11 PE=1 SV=1
sp|Q0CEX9|BTGE_ASPTN	4.56e-57	232	505	284	558	Probable beta-glucosidase btgE OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=btgE PE=3 SV=1
sp|A1DBG6|BTGE_NEOFI	1.52e-56	240	505	290	551	Probable beta-glucosidase btgE OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=btgE PE=3 SV=1
sp|Q4WC60|BTGE_ASPFU	2.70e-56	240	505	303	564	Probable beta-glucosidase btgE OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=btgE PE=3 SV=2
sp|B0Y9Q9|BTGE_ASPFC	2.70e-56	240	505	303	564	Probable beta-glucosidase btgE OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=btgE PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000594	0.999409	CS pos: 17-18. Pr: 0.8958

TMHMM  Annotations     

There is no transmembrane helices in C5_04110W_B-T-p1.