CAZyme Information: C4_06100W_B-T-p1

Basic Information

• Species: Candida albicans
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; Candida albicans
• CAZyme ID: C4_06100W_B-T-p1
• CAZy Family: GT2
• CAZyme Description: Processing alpha glucosidase I, involved in N-linked protein glycosylation and assembly of cell wall beta 1,6 glucan, rat catheter biofilm repressed

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
830		96255.74	4.6689

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CalbicansSC5314_B	6415	N/A	215	6200

• Gene Location: location=Ca22chr4B_C_albicans_SC5314:1355343-1357835(+)

Full Sequence      

MRLLSWLPFVFLLEVIFASNQIKFDLYDNNELQSNNDTVDLATQYSQISNSSLLWGPYRS
ALYFGLRPRFPRSLLSGLMWFSINDYEGIGKIRHFYEQHDKMSKANWVSYDPRIGGRQII
DDDECHIKIIIDFVKSDDGLSWGVKIRAKPHKGFENIKTSFIWYSGLEGEQKVIEENGDE
TTSRTGFLKLENPKNVLGYEGNVKFAGVSEELGAFELEINDGPKTNVHPAGRTDVDPELD
PRKAHHYSLTVPDDNVWRARDIFMTMLQESIQKLVEKFGGVEAIPPENLFILRDLQDFEG
NLHFVQKVYQGSCEFDVVYNNALTPITERITFDNLKFRIQNSLKAFDEKFNNHFELAPPF
NSKKYKKFGKEVLSGLLGGLSYFYGDQLVDRETVFDEDSFESYKLEGTFEGPYELFTLVP
SRPFFPRGFLWDEGFHLLPLLNYDSDLVLEITKSWFNLIDEDGWIAREQILGKESRSRVP
AEFVVQSPQIVNPPTLTLVLTYLLDSVVGNYDTINEPKNVDESLSRENLGGFVLKNPEVL
TNYTKQVYPKLKSHLDMFRRTQKGYVEEFDRGTNPEAYRWRGRTLTHCLASGLDDYPRAL
PADVAELNVDLISWIGIMTRSIRLMAEILNIDEDVETYKNLENDIIDNIEKLHWSPEDKT
YCDVSVNDDDENIFVCFKGYISLFPFLTKLIPEANTDKLEHIINLISNPEELWTPYGIRS
LSKADEFYKTGEDYWRSPIWIPINYLILDSIQDYYIRSKHHMSTDLQEKFAKTYHDLRIN
IVKNVFDQADKTGFVWEQYNDETGEAQRAKNFLGWSSLVLIMMTMPEHLQ

Enzyme Prediction     

EC	3.2.1.106:25	3.2.1.-:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH63	604	823	7.5e-35	0.43508771929824563

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397353	Glyco_hydro_63	0.0	330	825	1	494	Glycosyl hydrolase family 63 C-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the C-terminal catalytic domain.
407154	Glyco_hydro_63N	8.72e-109	53	285	1	221	Glycosyl hydrolase family 63 N-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the N-terminal beta sandwich domain.
225942	GDB1	4.68e-10	601	827	416	606	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
236653	PRK10137	2.04e-08	609	823	578	779	alpha-glucosidase; Provisional
283786	GDE_C	6.45e-06	620	802	177	354	Amylo-alpha-1,6-glucosidase. This family includes human glycogen branching enzyme AGL. This enzyme contains a number of distinct catalytic activities. It has been shown for the yeast homolog GDB1 that mutations in this region disrupt the enzymes Amylo-alpha-1,6-glucosidase (EC:3.2.1.33).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOW29337.1|GH63	0.0	1	830	1	830
ABB97046.1|GH63|3.2.1.106	0.0	1	830	1	830
CAX42430.1|GH63	0.0	1	829	1	829
EAZ62766.2|GH63	0.0	19	829	22	833
CAG87171.2|GH63	0.0	19	827	22	837

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4J5T_A	1.03e-206	39	820	1	797	Crystal structure of Processing alpha-Glucosidase I [Saccharomyces cerevisiae S288C]
5MHF_A	1.98e-98	53	823	37	775	Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_B Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_C Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_D Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P53008|CWH41_YEAST	7.50e-206	38	820	25	827	Mannosyl-oligosaccharide glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CWH41 PE=1 SV=1
sp|O14255|GCS1_SCHPO	3.78e-187	49	824	38	805	Probable mannosyl-oligosaccharide glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC6G10.09 PE=3 SV=1
sp|Q80UM7|MOGS_MOUSE	3.02e-102	53	823	92	830	Mannosyl-oligosaccharide glucosidase OS=Mus musculus OX=10090 GN=Mogs PE=1 SV=1
sp|O88941|MOGS_RAT	1.18e-99	55	823	94	830	Mannosyl-oligosaccharide glucosidase OS=Rattus norvegicus OX=10116 GN=Mogs PE=1 SV=1
sp|Q13724|MOGS_HUMAN	3.40e-99	53	823	94	833	Mannosyl-oligosaccharide glucosidase OS=Homo sapiens OX=9606 GN=MOGS PE=1 SV=5

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000262	0.999716	CS pos: 18-19. Pr: 0.9811

TMHMM  Annotations     

There is no transmembrane helices in C4_06100W_B-T-p1.