CAZyme Information: C4_06100W_A-T-p1

Basic Information

• Species: Candida albicans
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; Candida albicans
• CAZyme ID: C4_06100W_A-T-p1
• CAZy Family: GT2
• CAZyme Description: Cwh41p [Source:UniProtKB/TrEMBL;Acc:A0A1D8PMH9]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
830		96268.79	4.6902

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CalbicansSC5314	6468	237561	256	6212

• Gene Location: location=Ca22chr4A_C_albicans_SC5314:1355313-1357805(+)

Full Sequence      

MRLLSWLPFVFLLEVIFASNQIKFDLYDNNELQSNNDTVDLATQYSQISNSSLLWGPYRS
ALYFGLRPRFPRSLLSGLMWFSINDYEGIGKIRHFYEQHDKMSKANWVSYDPRIGGRQII
DDDECHIKIIIDFVKSDDGLSWGVKIRAKPHKGFENIKTSFIWYSGLEGEQKVIEENGDE
TTSRTGFLKLENPKNVLGYEGNVKFAGVSEELGAFELEINDGPKTNVHPAGRTDVDPELD
PRKAHHYSLTVPDDNVWRARDIFMTMLQESIQKLVEKFGGVEAIPPENLFILRDLQDFEG
NLHFVQKVYQGSCEFDVVYNNALTPITERITFENLKFRIQNSLKAFDEKFNNHFELAPPF
NSKKYKKFGKEVLSGLLGGLSYFYGDQLVDRETVFDEDSFESYKLEGTFEGPYELFTLVP
SRPFFPRGFLWDEGFHLLPLLNYDSDLVLEITKSWFNLIDEDGWIAREQILGKESRSRVP
AEFVVQSPQIVNPPTLTLVLTYLLDSVVGNYDTINEPKNVDESLSRENLGGFVLKNPEVL
TNYTKQVYPKLKSHLDMFRRTQKGYVEEFDRGTNPEAYRWRGRTLTHCLASGLDDYPRAL
PADVAELNVDLISWIGIMTRSIRLMAEILNIDEDVETYKNLENDIIDNIEKLHWSPEDKT
YCDVSVNDDDENIFVCFKGYISLFPFLTKLIPEANTDKLEHIINLISNPEELWTPYGIRS
LSKADEFYKTGEDYWRSPIWIPINYLILDSIQDYYIRSKHHMSTNLQEKFAKTYHDLRIN
IVKNVFDQADKTGFVWEQYNDETGEAQRAKNFLGWSSLVLIMMTMPEHLQ

Enzyme Prediction     

EC	3.2.1.106:25	3.2.1.-:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH63	604	823	7.5e-35	0.43508771929824563

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397353	Glyco_hydro_63	0.0	330	825	1	494	Glycosyl hydrolase family 63 C-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the C-terminal catalytic domain.
407154	Glyco_hydro_63N	7.75e-109	53	285	1	221	Glycosyl hydrolase family 63 N-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the N-terminal beta sandwich domain.
225942	GDB1	1.11e-09	601	827	416	606	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
236653	PRK10137	2.03e-08	609	823	578	779	alpha-glucosidase; Provisional
283786	GDE_C	2.59e-05	620	802	177	354	Amylo-alpha-1,6-glucosidase. This family includes human glycogen branching enzyme AGL. This enzyme contains a number of distinct catalytic activities. It has been shown for the yeast homolog GDB1 that mutations in this region disrupt the enzymes Amylo-alpha-1,6-glucosidase (EC:3.2.1.33).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOW29337.1|GH63	0.0	1	830	1	830
ABB97046.1|GH63|3.2.1.106	0.0	1	830	1	830
CAX42430.1|GH63	0.0	1	829	1	829
EAZ62766.2|GH63	0.0	19	829	22	833
CAG87171.2|GH63	0.0	19	827	22	837

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4J5T_A	1.45e-206	39	820	1	797	Crystal structure of Processing alpha-Glucosidase I [Saccharomyces cerevisiae S288C]
5MHF_A	1.98e-98	53	823	37	775	Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_B Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_C Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_D Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P53008|CWH41_YEAST	1.06e-205	38	820	25	827	Mannosyl-oligosaccharide glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CWH41 PE=1 SV=1
sp|O14255|GCS1_SCHPO	2.68e-187	49	824	38	805	Probable mannosyl-oligosaccharide glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC6G10.09 PE=3 SV=1
sp|Q80UM7|MOGS_MOUSE	3.02e-102	53	823	92	830	Mannosyl-oligosaccharide glucosidase OS=Mus musculus OX=10090 GN=Mogs PE=1 SV=1
sp|O88941|MOGS_RAT	8.48e-100	55	823	94	830	Mannosyl-oligosaccharide glucosidase OS=Rattus norvegicus OX=10116 GN=Mogs PE=1 SV=1
sp|Q13724|MOGS_HUMAN	3.40e-99	53	823	94	833	Mannosyl-oligosaccharide glucosidase OS=Homo sapiens OX=9606 GN=MOGS PE=1 SV=5

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000262	0.999716	CS pos: 18-19. Pr: 0.9811

TMHMM  Annotations     

There is no transmembrane helices in C4_06100W_A-T-p1.