CAZyme Information: C4_02100C_B-T-p1

Basic Information

• Species: Candida albicans
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; Candida albicans
• CAZyme ID: C4_02100C_B-T-p1
• CAZy Family: GT1
• CAZyme Description: Catalytic subunit of glycosylphosphatidylinositol-alpha 1,4 mannosyltransferase I, involved in GPI anchor biosynthesis, regulated by Tsa1p, Tsa1Bp under H2O2 stress conditions

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
398		46549.20	8.6910

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CalbicansSC5314_B	6415	N/A	215	6200

• Gene Location: location=Ca22chr4B_C_albicans_SC5314:418091-419287(-)

Full Sequence      

MSQLKYLITFSILLRFGFFFFGLYQDEYMPVKYTDIDYLVFNDASKFVYQGLSPYLRETY
RYTPILAILLIPDNFGKYWYHFGKLLFMVSDVITGLIILKLLSKQQQLSEKKKMILSSIW
LLNPMVITISTRGSAESVLTVMIMLSLYYLLDKDNVILSAIWLGLSIHFKIYPIIYLPSI
LYYLSSQETPFLASVPGINLVNAKNLKYIIITLTTLAVVNYLMFLKYGWEFIDNSYLYHV
TRLDHRHNFSVYNMVLYYKSALLEDSNGFDIEKIAFVPQLLLSAVIIPLIFAKEDLISSL
FIQTFVFVAFNKVITSQYFIWFLIFLPHFLSKTKLLTTDKITGISCLLLWIISQATWLYF
AYKLEFLGENTFDNGLMYSSVFFFLSNCWCTMKFIQSL

Enzyme Prediction     

EC	2.4.1.-:14

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT50	129	395	3.3e-91	0.9961832061068703

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
178434	PLN02841	8.03e-80	1	396	5	416	GPI mannosyltransferase
252941	Mannosyl_trans	3.00e-66	129	395	1	259	Mannosyltransferase (PIG-M). PIG-M has a DXD motif. The DXD motif is found in many glycosyltransferases that utilize nucleotide sugars. It is thought that the motif is involved in the binding of a manganese ion that is required for association of the enzymes with nucleotide sugar substrates.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOW28981.1|GT50	1.11e-279	1	398	1	398
AAV03184.1|GT50	3.07e-279	1	398	28	425
CAX42079.1|GT50	1.40e-251	1	398	1	402
CCE44265.1|GT50	3.57e-183	1	398	1	397
CCG23660.1|GT50	7.45e-183	1	398	1	398

PDB Hits     

C4_02100C_B-T-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5AMR5|GPI14_CANAL	1.97e-280	1	398	1	398	GPI mannosyltransferase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=GPI14 PE=3 SV=1
sp|Q6BHI9|GPI14_DEBHA	3.14e-169	3	398	5	410	GPI mannosyltransferase 1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / BCRC 21394 / JCM 1990 / NBRC 0083 / IGC 2968) OX=284592 GN=GPI14 PE=3 SV=2
sp|P47088|GPI14_YEAST	5.69e-109	7	398	8	389	GPI mannosyltransferase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GPI14 PE=1 SV=2
sp|Q4I073|GPI14_GIBZE	2.36e-107	7	389	13	399	GPI mannosyltransferase 1 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GPI14 PE=3 SV=1
sp|Q6CRE7|GPI14_KLULA	3.24e-105	7	372	8	361	GPI mannosyltransferase 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 GN=GPI14 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000012	0.000000

TMHMM  Annotations     

Start	End
7	24
79	101
114	136
156	178
208	225
275	292
304	326
341	362
375	397