CAZyme Information: C3_06090C_A-T-p1

Basic Information

• Species: Candida albicans
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; Candida albicans
• CAZyme ID: C3_06090C_A-T-p1
• CAZy Family: GH72|CBM43
• CAZyme Description: Initiation-specific alpha-1,6-mannosyltransferase [Source:UniProtKB/Swiss-Prot;Acc:Q5A4E3]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
385	Ca22chr3A_C_albicans_SC5314|CGC2	44827.62	8.6911

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CalbicansSC5314	6468	237561	256	6212

• Gene Location: location=Ca22chr3A_C_albicans_SC5314:1385507-1386664(-)

Full Sequence      

MLQLREPQMVHKHLKLAVLGIVVIFTTYFIISSLSSPTSTHKTEYNSPKLQLAKELELNS
NWKELGLNFQPNKKYSLPDESTLRQQLSYQFPYDESKPFPKNIWQTWKVGIDEKSFPKRY
LKYQQTWEDKNPDYKHYVVPDKQCDLLIEQLYSQVPDVAKAYRIMPKSILKADFFRYLIL
FARGGVYTDIDTVGLKPVDEWISNSEMILEKKNRSGLVVGIEADPDRPDWADWYARRIQF
CQWTIQSKRGHPMLRELIAKITDITLTRHKKGQLKKVLGKNEGGDIMNWTGPGIFTDTVF
EYMNNILQSPEVFKNKKKWATIIDWKLFTGMEQPIAIDDVLVLPITSFSPDVNQMGAKDS
HDPMAYAKHMFSGSWKDDGMPEMEQ

Enzyme Prediction     

EC	2.4.1.257:12

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	119	204	9e-21	0.9666666666666667

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	2.19e-49	79	378	62	347	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	4.35e-18	117	205	1	90	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOW28617.1|GT32	8.93e-293	1	385	1	385
AAL49987.1|GT32|2.4.1.257	7.34e-292	1	385	1	385
CAX43101.1|GT32	1.58e-279	1	384	1	384
ABN65126.2|GT32	2.64e-198	9	378	1	369
CCG25808.1|GT32	1.45e-189	12	383	4	360

PDB Hits     

C3_06090C_A-T-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5A4E3|OCH1_CANAL	1.59e-293	1	385	1	385	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P31755|OCH1_YEAST	2.83e-105	37	378	54	472	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|Q9UTR6|OCH1_SCHPO	1.54e-80	88	378	131	396	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|P47124|HOC1_YEAST	5.27e-68	78	385	109	395	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|Q10323|IMT3_SCHPO	9.57e-07	94	191	52	142	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000030	0.000002

TMHMM  Annotations     

Start	End
13	35