CAZyme Information: C3_03450C_B-T-p1

Basic Information

• Species: Candida albicans
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; Candida albicans
• CAZyme ID: C3_03450C_B-T-p1
• CAZy Family: GH5
• CAZyme Description: Beta-mannosyltransferase, member of a 9-gene family that includes characterized genes BMT1, BMT2, BMT3, and BMT4 with roles in beta-1,2-mannosylation of cell wall phosphopeptidomannan, downregulated in azole-resistant strain, Hap43p-induced

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
651		75181.17	7.4386

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CalbicansSC5314_B	6415	N/A	215	6200

• Gene Location: location=Ca22chr3B_C_albicans_SC5314:728893-730848(-)

Full Sequence      

MKLEMSSYLHKVPNTGITNLSNSKSIVFIMFCATLLFIITSSRYLTGSESLGQIPSEIPK
SSEQLNEELSQQINSKLHKLASFDKFNSFPLLNKHMKDDIYGSMTLETFTDPLPYLENYN
EEEYSQQNYPICSEKLMFPSKIKLTKQQYLLADLQQFLGVLNNMRPYHDMVEKAKAYFIS
DLREEKKWFRFAGSSIWLPQFQCHYMVSRYLYSPNGVANHAFASFLYIQLFDSDWKELPS
HTTLDIPFEQTEANSIFKIFKPKQKYANFRNSTYPQILPIPFDYKLPIETKKYYYGPEDP
RILLRSNPLGFDEPLIVFNMKGLKLTKRVMYSYLPFSNTLKLLKKRREPFANIEKNWTPF
KSVAQPSKTQTTIHFIYSMIPLEVLACDIDSGLCDILQKPAKHDFNYVGGLRGGTQLVSL
PLNETIPSEIRAKLPIPKNRQVYIGWARTHLNNCGCGDSMYRPNFITLVEDYDDVTDKYY
YKIGDISGYFDFAAKIEPWSKQVLDEEGNLYEKAEQCQGRNVLIPNSIAYWDVGSIKLAG
TEYQKHDFKDMFSSGKVSDFNANEIVFNDYMGVTLSSADRDVSIVHVKGLLNYILQLPSL
VDDSLVINKEWTFQKKGHDLNVRCAMIASKEYCKSYAIKQGVKIDEKSEET

Enzyme Prediction     

No EC number prediction in C3_03450C_B-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT91	133	632	8.3e-152	0.9955654101995566

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
403385	DUF3589	0.0	132	632	2	485	Protein of unknown function (DUF3589). This family of proteins is found in eukaryotes. Proteins in this family are typically between 541 and 717 amino acids in length. The function of this family is not known,

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOW28373.1|GT91	0.0	1	651	1	651
CAX42859.1|GT91	0.0	1	651	1	651
CCE40237.1|GT91	8.34e-200	88	650	90	643
CCG22109.1|GT91	3.82e-198	87	649	89	643
EAZ62799.2|GT91	6.38e-197	59	645	36	637

PDB Hits     

C3_03450C_B-T-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5AEC6|BMT7_CANAL	0.0	1	651	1	651	Beta-mannosyltransferase 7 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=BMT7 PE=2 SV=1
sp|Q5AHD6|BMT8_CANAL	1.89e-64	140	639	125	649	Beta-mannosyltransferase 8 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=BMT8 PE=3 SV=1
sp|C4R7X9|BMT1_KOMPG	1.82e-57	107	641	58	533	Beta-mannosyltransferase 1 OS=Komagataella phaffii (strain GS115 / ATCC 20864) OX=644223 GN=BMT1 PE=3 SV=1
sp|F2QZ65|BMT1_KOMPC	1.82e-57	107	641	58	533	Beta-mannosyltransferase 1 OS=Komagataella phaffii (strain ATCC 76273 / CBS 7435 / CECT 11047 / NRRL Y-11430 / Wegner 21-1) OX=981350 GN=BMT1 PE=3 SV=2
sp|F2QQ67|BMT3_KOMPC	1.11e-54	102	641	48	515	Beta-mannosyltransferase 3 OS=Komagataella phaffii (strain ATCC 76273 / CBS 7435 / CECT 11047 / NRRL Y-11430 / Wegner 21-1) OX=981350 GN=BMT3 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000014	0.000011

TMHMM  Annotations     

Start	End
20	42