CAZyme Information: C3_02960C_A-T-p1

Basic Information

• Species: Candida albicans
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; Candida albicans
• CAZyme ID: C3_02960C_A-T-p1
• CAZy Family: GH5
• CAZyme Description: Kre5p [Source:UniProtKB/TrEMBL;Acc:A0A1D8PJN6]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1447		166120.76	4.9629

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CalbicansSC5314	6468	237561	256	6212

• Gene Location: location=Ca22chr3A_C_albicans_SC5314:630423-634766(-)

Full Sequence      

MSIARYIYYTIAVAVLLNFVKATENNNFKLELEASWSNIDFLPSFIEAIVGFNDSLYEQT
IETIFGLGDTEVELEDDASDQEIYSTVINSLRLTDQDLDFINFDLTNKKHTPRIAAHYDH
YSDVLTKFGDRLKSECAKDSFGNAVETKNGQIQTWLLYNDKIYCSANDLFALRTDLSSHS
TLLFDRIIGKSKDAPLVILYGNPTEESTKDFLKILYPDAKAGKLKFVWRYIPSGIKKSDS
ISGYGVSLKMEKYDYSGAEGNTKYDLSRDFTRINDSQELVLVIGKHSYELGVKLTSFILS
NRYKTTKYDLLDTILTNFPKFIPYIARLPKLLNHEKVKSKVLGNEDIGLSQDSYGIYING
SPINPLELDIYNLGTRIKEELQTVKDLVKLGFDTVQAKLLIAKFALLSAVKQTQFRNGNT
LMGNNENRFKVYENEFKKGSSEKGGVLFFNNIESDNTFKEYTTDREEAYLGVGSHKLKPN
QIPLLKENIHDLIFALNFGNKNQLRVFFTLSKVILDSGIPQQVGVLPVIGDDPMDSLLAE
KFYWIAEKSSTQEALAILYKYFESNSPDEVDDLLDKVEVPEDYKVDYNHVLNKFSISTAS
VIFNGVIYDLRAPNWQIAMSKQISQDISLIKTFLRQGPIEGRLKDVLYSNAKSERNLRII
PLEPSDIIYKKIDKELINNSIAFKKLDKAQGVSGTFWLVSDFTKSEIITQLIDLLLLLKK
KAIQIRIINTGDTDVFGKLKTKFKLTALTNGQIDEIIEILKKSNASSANNDELKKMLETK
QLPAHHSFLLFNSRYFRLDGNFGYEELDQIIEFEVSQRLNLIPDIMEAYPDEFRSKKVSD
FNSVLSGLDNMDWFDLVTSIVTKSFHVDEKRFIVDVNRFDFSSLDFSNSIDVTTYEENSP
VDVLIILNPMDEYSQKLISLVNSITDFSFLNIRILLQPRVDSKEEIKIHKFYRGVYPQPT
PKFDSNGKWIQHYSAQFESIPSNVTYSTELDVPHKWIVVPQSSSMDLNTINFSESHSVDA
KYSLKNILIEGYARDIHTGKAPDGLIFRAFNKNYSTDTLVMTSLDYFQIKGYPSIFNFST
TSNDTLLSASENKYQANTEELESIEVPVFKIDGSTIYPRVMKSGNNKPMSTRKHADINIF
TIAGGQLYEKLTSIMIASVRKHNPSSTIKFWILEDFATPQFKHLVELISVKYNVEYEFIS
YKWPNFLRKQKTKERMIWGYKILFLDVLFPQDLNKIIFIDADQICRADLTELVNMDLEGA
PYGFTPMCDSREEMEGFRFWKEGYWSDVLKDDLKYHISALFVVDLQKFRSIKAGDRLRAH
YQKLSSDPNSLSNLDQDLPNNMQRSIKIFSLPQNWLWCETWCSDKSLEDAKMIDLCNNPL
TRENKLDAAKRLIPEWIEYEQAIEPLVSLVQNNTAKEVVQEIEIDTDGEQEEQEQESNDD
DFIHDEL

Enzyme Prediction     

EC	2.4.1.-:29

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT24	1137	1386	6.2e-124	0.9959677419354839

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
408203	Glyco_transf_24	0.0	1137	1406	1	268	Glucosyltransferase 24. This is the catalytic domain found in UDP-glucose:glycoprotein glucosyltransferase (UGGT). This domain belongs to glucosyltransferase 24 family (GT24) A-type domain. The GT domain displays the expected glycosyltransferase type A (GT-A) fold.
133054	GT8_HUGT1_C_like	4.77e-144	1137	1386	1	248	The C-terminal domain of HUGT1-like is highly homologous to the GT 8 family. C-terminal domain of glycoprotein glucosyltransferase (UGT). UGT is a large glycoprotein whose C-terminus contains the catalytic activity. This catalytic C-terminal domain is highly homologous to Glycosyltransferase Family 8 (GT 8) and contains the DXD motif that coordinates donor sugar binding, characteristic for Family 8 glycosyltransferases. GT 8 proteins are retaining enzymes based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. The non-catalytic N-terminal portion of the human UTG1 (HUGT1) has been shown to monitor the protein folding status and activate its glucosyltransferase activity.
132996	Glyco_transf_8	3.33e-45	1137	1379	1	241	Members of glycosyltransferase family 8 (GT-8) are involved in lipopolysaccharide biosynthesis and glycogen synthesis. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. GT-8 comprises enzymes with a number of known activities: lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, glycogenin glucosyltransferase, and N-acetylglucosaminyltransferase. GT-8 enzymes contains a conserved DXD motif which is essential in the coordination of a catalytic divalent cation, most commonly Mn2+.
408199	Thioredoxin_12	2.67e-33	41	233	4	179	Thioredoxin-like domain. This is one of four TRXL(thioredoxin-like) domains found in UDP-glucose:glycoprotein glucosyltransferase (UGGT).
408201	Thioredoxin_14	8.36e-27	442	659	9	248	Thioredoxin-like domain. This is the third out of four TRXL(thioredoxin-like) domains found in UDP-glucose:glycoprotein glucosyltransferase (UGGT).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOW28327.1|GT24	0.0	1	1447	1	1447
CAC18923.1|GT24|2.4.1.-	0.0	1	1447	1	1447
CCG22175.1|GT24	0.0	30	1447	31	1440
CCE40308.1|GT24	0.0	19	1447	32	1453
ABN66217.2|GT24	0.0	8	1407	6	1475

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MU1_A	6.90e-163	32	1416	15	1457	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5MZO_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5N2J_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5N2J_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TRF_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
5NV4_A	9.56e-163	32	1416	15	1457	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TRT_A	1.30e-161	32	1416	15	1457	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TS2_A	8.27e-137	906	1416	661	1223	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_C Chain C, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_D Chain D, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TS8_A	2.60e-130	32	1348	8	1382	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS8_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q09140|UGGG_SCHPO	5.38e-162	43	1417	33	1435	UDP-glucose:glycoprotein glucosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gpt1 PE=1 SV=2
sp|Q9NYU2|UGGG1_HUMAN	6.21e-126	164	1406	159	1523	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=UGGT1 PE=1 SV=3
sp|Q6P5E4|UGGG1_MOUSE	2.81e-125	153	1409	148	1526	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Mus musculus OX=10090 GN=Uggt1 PE=1 SV=4
sp|Q9JLA3|UGGG1_RAT	7.60e-123	186	1409	185	1526	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Uggt1 PE=1 SV=2
sp|Q09332|UGGG_DROME	4.14e-121	32	1413	34	1514	UDP-glucose:glycoprotein glucosyltransferase OS=Drosophila melanogaster OX=7227 GN=Uggt PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000200	0.999766	CS pos: 22-23. Pr: 0.9807

TMHMM  Annotations     

There is no transmembrane helices in C3_02960C_A-T-p1.