CAZyme Information: C3_02140C_A-T-p1

Basic Information

• Species: Candida albicans
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; Candida albicans
• CAZyme ID: C3_02140C_A-T-p1
• CAZy Family: GH5
• CAZyme Description: Has domain(s) with predicted catalytic activity and role in carbohydrate metabolic process

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
405	Ca22chr3A_C_albicans_SC5314|CGC7	46230.12	5.5114

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CalbicansSC5314	6468	237561	256	6212

• Gene Location: location=Ca22chr3A_C_albicans_SC5314:463157-464374(-)

Full Sequence      

MSFPPLENPNLEGYEIARQLWIEYYNQREGTFVARKKCNGCYNENKFVVWAVAVAAQAIV
DGARIYPELKPLVGPAIQIFQKYKNNHIKGYSAAENSGNDQDIYYDDDAQVASAIITAYE
VTGDKSFLDQGRELVRFLMSGWNDKPDAKTKGGVHWHVSKNYLNACTTAEVAKACLQISK
FLPEEAGVYIDFAAKCIDWQIQVLQDPGDKLIKDGVSDKDTKINDVKWTYNVGTTLSAAA
HLYFITKDDKWKQISQDLAKAGINRGVFFYDRDFDNSKRYWRDSSYFVQLLIEGLADYLL
YVGNDVPDELVGKIQEEIKRHLIIFYEFMKDPKDGMYIQSFEPHNTYREVYDQKYKNFFG
DGKGWGLKGEDKDENGNPSKCLMGYAAAARVFFQGARVVPHIDSY

Enzyme Prediction     

No EC number prediction in C3_02140C_A-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	16	308	2.8e-48	0.7653631284916201

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397638	Glyco_hydro_76	1.28e-35	82	297	66	290	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.
227170	COG4833	3.62e-10	85	313	72	292	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOW28251.1|GH76	3.23e-312	1	405	1	405
CCE44696.1|GH76	1.18e-236	2	403	3	404
CCG25815.1|GH76	1.95e-235	2	403	3	404
CAG87426.1|GH76	3.81e-218	6	403	3	400
CCE73401.1|GH76	5.22e-218	5	403	2	398

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4C1S_A	6.34e-15	65	261	70	267	Glycoside hydrolase family 76 (mannosidase) Bt3792 from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482],4C1S_B Glycoside hydrolase family 76 (mannosidase) Bt3792 from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482]
6SHD_A	2.35e-09	15	266	56	298	Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_B Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_C Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6]
6SHM_A	4.10e-08	15	266	57	299	An inactive (D136A and D137A) variant of alpha-1,6-mannanase, GH76A of Salegentibacter sp. HEL1_6 in complex with alpha-1,6-mannotetrose [Salegentibacter sp. Hel_I_6]
6Y8F_A	4.10e-08	15	266	57	299	Chain A, Alpha-1,6-endo-mannanase GH76A mutant [Salegentibacter sp. Hel_I_6]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O14131|MU191_SCHPO	1.22e-33	21	399	21	414	Meiotically up-regulated gene 191 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mug191 PE=1 SV=1
sp|O74556|YCZ2_SCHPO	4.00e-06	106	275	115	291	Putative mannan endo-1,6-alpha-mannosidase C970.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC970.02 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000050	0.000000

TMHMM  Annotations     

There is no transmembrane helices in C3_02140C_A-T-p1.