CAZyme Information: C3_01820W_B-T-p1

Basic Information

• Species: Candida albicans
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; Candida albicans
• CAZyme ID: C3_01820W_B-T-p1
• CAZy Family: GH38
• CAZyme Description: Protein of unknown function, expression downregulated in an ssr1 null mutant

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
865		97277.42	5.3003

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CalbicansSC5314_B	6415	N/A	215	6200

• Gene Location: location=Ca22chr3B_C_albicans_SC5314:402488-405085(+)

Full Sequence      

MTDSFDIDNILSQLTLEEKIGLVGGIDFWHTYPISRLNIPKVRFTDGPNGIRGTRFFNGV
PSACFPCGTGLAATFDHELLLTTGKLMNIEAKFKNAHVILGPTMNIQRGPLGGRGFESFS
EDPYLTGQIASAIIKGIQYDNEIGATVKHYVCNDLEDERSASDSLVTPRALREIYLEPFR
IAIKESNPICLMTGYNKVNGEHVSQSKFFLQNILRDEWNWQGTIISDWYGTYTSKKAIEN
GLDLEMPGSPIFRNKQLLTSMIKSKELHIKHLDDRVKNVLKLIKFAKQSSVVVTEDGKES
SENNTQETRDILRKLAQDSIVLLKNDNNLLPLKRDDVDFSSKSIAIIGPNAKIAAYSGGG
SATLPAYYTTTPYNAIVEKLSSISKFDITSQLKYTIGAKAYKYLPELGPQVINPKTGKPG
FSMKFYKKPKSVPNENRELFDELDTEISDILLGDYYHKDIPSNGLYYIDFECEFTPSKTQ
HYEFGLTVHGTAQLFIDDKLVVDNKTKQIKGVSFLNSGTIEERGSIELHQGKTYKIIVEY
GSAPTFTLKDQVGEYFGGGIRLGMNEIINDDEQEIINAVNLAKSVDLVILIIGLNKDWES
ESYDRPDMKLPGLQDKLIESVLDVNPNTIIVNQSGTPVEFSEWLDKSKALLHCWYGGNES
GNAIADILFGDVNPNGKLSLTFPLKNNDNPTFLNFKTERGRVLYGEDIFVGYRYYEKLNR
QVAFPFGFGLSYTKFEFFDLKLEKKTKDKEEEEEEESLVVSLSVKNIGKMTGSEVIQVYV
SKVESDVIRPIKELKGFTKVNLQPNETKSVNLKLIIKDSVSFFDEYANQWSVQSGQYKVH
VGNSSDNIPLTESFTIEKSYFWSGL

Enzyme Prediction     

EC	3.2.1.21:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	34	247	9.6e-59	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	4.38e-71	3	856	35	764	beta-glucosidase BglX.
224389	BglX	3.04e-64	14	385	17	395	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	1.36e-55	320	712	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
178629	PLN03080	1.06e-41	10	737	56	638	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	7.67e-34	35	282	62	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOW28223.1|GH3	0.0	1	865	1	866
CAG85284.2|GH3	0.0	5	865	71	904
ABN67130.1|GH3	0.0	5	864	6	838
CDR44766.1|GH3	0.0	5	865	4	839
CDR47499.1|GH3	0.0	1	865	1	839

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	3.68e-298	5	865	4	845	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	1.80e-293	5	865	4	845	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	1.37e-131	6	859	4	671	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	2.15e-99	11	857	9	664	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	8.39e-85	7	856	4	713	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P07337|BGLS_KLUMA	7.48e-292	5	865	4	845	Beta-glucosidase OS=Kluyveromyces marxianus OX=4911 PE=3 SV=1
sp|Q9P6J6|BGLS_SCHPO	2.41e-279	6	865	5	832	Putative beta-glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1683.04 PE=3 SV=1
sp|Q2U8Y5|BGLI_ASPOR	5.75e-269	6	865	5	839	Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglI PE=3 SV=1
sp|B8NDE2|BGLI_ASPFN	9.29e-268	6	865	5	839	Probable beta-glucosidase I OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglI PE=3 SV=2
sp|Q0CAF5|BGLI_ASPTN	7.83e-264	6	865	5	839	Probable beta-glucosidase I OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.993465	0.006573

TMHMM  Annotations     

There is no transmembrane helices in C3_01820W_B-T-p1.