CAZyme Information: C2_10150W_B-T-p1

Basic Information

• Species: Candida albicans
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; Candida albicans
• CAZyme ID: C2_10150W_B-T-p1
• CAZy Family: GH3
• CAZyme Description: Secreted protein, fluconazole-induced

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
401		45007.30	4.6620

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CalbicansSC5314_B	6415	N/A	215	6200

• Gene Location: location=Ca22chr2B_C_albicans_SC5314:2084295-2085500(+)

Full Sequence      

MNIIIISLILSLLNCSYTLSAPSTTLFPKRDTFDPTSAFNSAINATWSVFWNDQYQAFSE
NDPACSMTSTNNFTYTSVWNLAVAGKVIVESGDIFKTINVINNLYQYQNSQGWFATVPNS
SESFVDDNCQVLWVFIEAYKLTSNAKYLSTANQLMQLIQQQWSNIGGVIWKVDSNYIASI
STVEAALSAVKIYQYNQDDTLLTFANSCLGWLDEHLTDPADGFYYDGIDKNTWQVNKGKL
TYTIGVAMSTYSYLYKYTNDLHYVLYAVKKAYGTLNSNVFLRSNGYWNNDLKYIHLLFAG
FADVITMCGQKGYIANVVKQGEFIYNYDQLPNSLGSYLDFTNSQPLYNRYVQSTGDSSIT
MGSSNGGAGASENGYCGNQPKRSLLDNASAAQIFYQISRFY

Enzyme Prediction     

No EC number prediction in C2_10150W_B-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	66	310	3.5e-31	0.7122905027932961

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397638	Glyco_hydro_76	7.93e-15	99	307	59	294	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOW27992.1|GH0	1.45e-297	1	401	1	401
AOW27980.1|GH0	6.32e-157	6	399	8	410
AOW27993.1|GH0	5.97e-149	6	400	7	416
CCG26053.1|GH0	1.73e-125	29	399	21	383
CCE44944.1|GH0	6.17e-121	29	399	21	383

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4MU9_A	6.05e-14	124	301	116	300	Crystal structure of a putative glycosylhydrolase (BT_3782) from Bacteroides thetaiotaomicron VPI-5482 at 1.89 A resolution [Bacteroides thetaiotaomicron VPI-5482],4MU9_B Crystal structure of a putative glycosylhydrolase (BT_3782) from Bacteroides thetaiotaomicron VPI-5482 at 1.89 A resolution [Bacteroides thetaiotaomicron VPI-5482]
6SHD_A	9.38e-14	124	271	133	286	Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_B Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_C Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6]
6Y8F_A	3.02e-13	119	271	128	287	Chain A, Alpha-1,6-endo-mannanase GH76A mutant [Salegentibacter sp. Hel_I_6]
6SHM_A	4.04e-13	136	271	146	287	An inactive (D136A and D137A) variant of alpha-1,6-mannanase, GH76A of Salegentibacter sp. HEL1_6 in complex with alpha-1,6-mannotetrose [Salegentibacter sp. Hel_I_6]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O14131|MU191_SCHPO	1.27e-06	40	254	8	248	Meiotically up-regulated gene 191 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mug191 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000256	0.999698	CS pos: 20-21. Pr: 0.8790

TMHMM  Annotations     

There is no transmembrane helices in C2_10150W_B-T-p1.