CAZyme Information: C2_10030C_B-T-p1

Basic Information

• Species: Candida albicans
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; Candida albicans
• CAZyme ID: C2_10030C_B-T-p1
• CAZy Family: GH20
• CAZyme Description: Cell surface mannoprotein, cell-wall glucan metabolism, adhesion, adhesin motif, O-glycosylation, induced by heat, germ tube formation, wall regeneration, mycelial antigen, diagnostic marker, fluconazole-repressed, Spider biofilm induced

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
378	Ca22chr2B_C_albicans_SC5314|CGC2	39260.37	4.8673

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CalbicansSC5314_B	6415	N/A	215	6200

• Gene Location: location=Ca22chr2B_C_albicans_SC5314:2053367-2054503(-)

Full Sequence      

MLFKSFVTFTVLANALAAPLAHQHHQHKEEKRAVHVVTTTNVVVVTIGNGDQTTTFAAPS
VAAESSVSVSVNTEPPQNHPTTTQDVASASTYPSSTDGSAASSSAAASSSSQAGSEPSGG
VGSGGAKGITYSPYSDNGGCKSESQIASEIAQLSGFDVIRLYGVDCDQVSAVLKAKTSSQ
KIFAGIFDVSNIASGIESLAEAVEACGSWDDIYTVSIGNELVNAGSATPSQIKAYVDEGR
KALKAAGYTGPVVSVDTFIAVINNPELCEYSDYMAVNAHAFFDGHVAAENSGPWVLQQIQ
RVWTACSGKKNVLITETGWPSKGDSNGLAVPSKSNQQAAISSIKSSCGASALLFTAFNDL
WKADGPYNAEKYWGIYSN

Enzyme Prediction     

No EC number prediction in C2_10030C_B-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	128	377	6.9e-27	0.9581993569131833

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	9.36e-98	129	378	48	303	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
366033	Glyco_hydro_17	0.001	211	377	132	298	Glycosyl hydrolases family 17.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOW27981.1|GH17	2.34e-232	1	378	1	378
AAV03539.1|GH17	7.01e-230	1	378	32	409
CAC19886.1|GH17	5.44e-229	1	378	1	379
CAX44189.1|GH17	4.46e-215	1	378	1	373
CCG26047.1|GH17	3.37e-154	1	378	1	376

PDB Hits     

C2_10030C_B-T-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q59XX2|MP65_CANAL	4.15e-233	1	378	1	378	Cell surface mannoprotein MP65 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MP65 PE=1 SV=3
sp|Q04951|SCW10_YEAST	2.11e-126	125	378	135	388	Probable family 17 glucosidase SCW10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SCW10 PE=1 SV=1
sp|P53334|SCW4_YEAST	3.84e-126	125	378	132	385	Probable family 17 glucosidase SCW4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SCW4 PE=1 SV=1
sp|Q4WC60|BTGE_ASPFU	4.31e-49	125	376	307	561	Probable beta-glucosidase btgE OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=btgE PE=3 SV=2
sp|B0Y9Q9|BTGE_ASPFC	4.31e-49	125	376	307	561	Probable beta-glucosidase btgE OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=btgE PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000293	0.999716	CS pos: 32-33. Pr: 0.4377

TMHMM  Annotations     

There is no transmembrane helices in C2_10030C_B-T-p1.