CAZyme Information: C2_09150W_B-T-p1

Basic Information

• Species: Candida albicans
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; Candida albicans
• CAZyme ID: C2_09150W_B-T-p1
• CAZy Family: GH18
• CAZyme Description: Mannosylinositol phosphorylceramide (MIPC) synthase catalytic subunit, sphingolipid biosynthesis, fluconazole, caspofungin induced, macrophage-repressed, Spider biofilm induced

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
544	Ca22chr2B_C_albicans_SC5314|CGC1	61862.99	7.6989

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CalbicansSC5314_B	6415	N/A	215	6200

• Gene Location: location=Ca22chr2B_C_albicans_SC5314:1880342-1881976(+)

Full Sequence      

MRKELKCIIWAHVGLIVYLLYLSFDLLSLLNDDIFSDALLDVEINPNPSTSLNKPAIIPK
IIHQTYKTTDIPEIWKPGQQACINLHQDDYQYFLWTDESAREFINKEFNWFIDTWDNYKY
PIQRADAIRYFALYYYGGIYIDLDDGCKRKLDPLLTVPAFVRKTAPTGISNDVMGSVPNH
PFFLKVIQDLEKYQRNWLVPYITIMMSTGPLFLSIMWKQYKRWGVPEAGKVRILLPQNYK
GTTSSYFAIVRGSSWHMGDANFIKSLGDHLVLAVIGGFLLGLLILFVEYLFYSWVISSQC
KRLTSKLLSFTWAILMGVLRFFHLDKLLSKCDFWSRSTKYEEMLLPKDSNDLKNINNNNT
SNNNTNGGDSNNNDKSDYNNNDNNNNNINNHTGKTRLSSIFNILGGKTKVKRRNRKDSNL
PIEIDVLSKLLDDTVIIDASTTETPTNPVSPTPSPISPTINSRTSNNELLIPTNNNNNNN
NNTNDNTNNVNNINNRTTCDDQSTLLPYSTRLSSSSSSSSSSPSSSTSSLPSHETIMKLN
NDIV

Enzyme Prediction     

EC	2.4.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	75	155	8.1e-22	0.9333333333333333

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	1.11e-65	23	270	52	295	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	2.26e-19	72	155	1	87	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOW27901.1|GT32	0.0	1	544	1	544
CAX44109.1|GT32	2.86e-316	1	544	1	540
CCG25834.1|GT32	4.21e-179	1	437	1	395
CCE44715.1|GT32	6.33e-179	1	448	1	408
ABN66494.2|GT32	8.38e-160	1	355	1	350

PDB Hits     

C2_09150W_B-T-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P33300|SUR1_YEAST	2.32e-127	1	305	1	301	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|P38287|CSH1_YEAST	3.45e-125	1	298	1	302	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|Q9UT67|IMT2_SCHPO	6.60e-83	57	306	81	331	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1
sp|Q10323|IMT3_SCHPO	6.21e-76	39	279	38	278	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|O14084|IMT1_SCHPO	5.12e-50	35	260	44	266	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000027	0.000010

TMHMM  Annotations     

Start	End
7	29
197	216
270	292
307	324